KEGG   Homo sapiens (human): 419Help
Entry
419               CDS       T01001                                 

Gene name
ART3, ARTC3
Definition
ADP-ribosyltransferase 3 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     419 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.1; 4p15.1-p14
AA seq 389 aa AA seqDB search
MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEK
ASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVK
MAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARF
GHFTLAYSAKPQAANDQLTVLSIYTCLGVDIENFLDKESERITLIPLNEVFQVSQEGAGN
NLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVYNPGEKNQKLEDHSEKNWKLE
DHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPVPVPGPKSHPS
ASSGKLLLPQFGMVIILISVSAINLFVAL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgggacattttgaaatagtcaccatgctgctggcaaccatgattctagtggac
attttccaggtgaaggctgaagtgttagacatggcagataatgcatttgatgatgaatac
ctgaaatgtacggacaggatggaaattaaatacgttccccaactgctaaaggaggaaaaa
gcaagccaccagcaattagatactgtgtgggaaaatgcaaaagccaaatgggcagcccga
aagactcaaatctttctccctatgaattttaaggataaccatggaatagccctgatggca
tatatttccgaagctcaagagcaaactcccttttaccatctgttcagtgaagctgtgaag
atggctggccaatctcgagaagattatatctatggcttccagttcaaagctttccacttt
tacctcacaagagccctgcagttgctgagaaaaccttgtgaggccagttccaaaactgtg
gtatatagaacaagccagggcacttcatttacatttggagggctaaaccaagccaggttt
ggccattttaccttggcatattcagccaaacctcaggctgctaatgaccagctcactgtg
ttatccatctacacatgccttggagttgacattgaaaattttcttgataaagaaagtgaa
agaattactttaatacctctgaatgaggtttttcaagtgtcacaggagggggctggcaat
aaccttatccttcaaagcataaacaagacctgcagccattatgagtgtgcatttctaggt
ggactaaaaaccgaaaactgtattgagaacctagaatattttcaacccatctatgtctac
aaccctggtgagaaaaaccagaagcttgaagaccatagtgagaaaaactggaagcttgaa
gaccatggtgagaaaaaccagaagcttgaagaccatggtgtgaaaatccttgaacccacc
caaatacctggaatgaaaattccagaaccttttccactacctgaagataaaagtcaagga
aatatcaacaatcctactccaggtccagttcctgttccaggtcccaaaagccatccttct
gcatcctcgggcaaactgctgcttccacagtttgggatggtcatcattttaatcagtgtt
tctgctataaatctctttgttgctctgtag

DBGET integrated database retrieval system