KEGG   Homo sapiens (human): 4190Help
Entry
4190              CDS       T01001                                 

Gene name
MDH1, HEL-S-32, MDH-s, MDHA, MGC:1375, MOR2
Definition
malate dehydrogenase 1, NAD (soluble) (EC:1.1.1.37 1.1.1.96)
Orthology
K00025  
malate dehydrogenase [EC:1.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Proximal tubule bicarbonate reclamation
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hsa00630]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.3
AA seq 352 aa AA seqDB search
MRRCSYFPKDVTVFDKDDKSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLD
ITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLL
KANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNR
AKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGE
FVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPD
DLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgctgcagctattttccaaaggacgttacggtgtttgataaggacgataagtct
gaaccaatcagagtccttgtgactggagcagctggtcaaattgcatattcactgctgtac
agtattggaaatggatctgtctttggtaaagatcagcctataattcttgtgctgttggat
atcacccccatgatgggtgtcctggacggtgtcctaatggaactgcaagactgtgccctt
cccctcctgaaagatgtcatcgcaacagataaagaagacgttgccttcaaagacctggat
gtggccattcttgtgggctccatgccaagaagggaaggcatggagagaaaagatttactg
aaagcaaatgtgaaaatcttcaaatcccagggtgcagccttagataaatacgccaagaag
tcagttaaggttattgttgtgggtaatccagccaataccaactgcctgactgcttccaag
tcagctccatccatccccaaggagaacttcagttgcttgactcgtttggatcacaaccga
gctaaagctcaaattgctcttaaacttggtgtgactgctaatgatgtaaagaatgtcatt
atctggggaaaccattcctcgactcagtatccagatgtcaaccatgccaaggtgaaattg
caaggaaaggaagttggtgtttatgaagctctgaaagatgacagctggctcaagggagaa
tttgtcacgactgtgcagcagcgtggcgctgctgtcatcaaggctcgaaaactatccagt
gccatgtctgctgcaaaagccatctgtgaccacgtcagggacatctggtttggaacccca
gagggagagtttgtgtccatgggtgttatctctgatggcaactcctatggtgttcctgat
gatctgctctactcattccctgttgtaatcaagaataagacctggaagtttgttgaaggt
ctccctattaatgatttctcacgtgagaagatggatcttactgcaaaggaactgacagaa
gaaaaagaaagtgcttttgaatttctttcctctgcctga

DBGET integrated database retrieval system