KEGG   Homo sapiens (human): 4191Help
Entry
4191              CDS       T01001                                 

Gene name
MDH2, M-MDH, MDH, MGC:3559, MOR1
Definition
(RefSeq) malate dehydrogenase 2 (EC:1.1.1.37)
  KO
K00026  
malate dehydrogenase [EC:1.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4191 (MDH2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4191 (MDH2)
   00620 Pyruvate metabolism
    4191 (MDH2)
   00630 Glyoxylate and dicarboxylate metabolism
    4191 (MDH2)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4191 (MDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4191 (MDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7cen-q22
AA seq 338 aa AA seqDB search
MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA
KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE
KNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgccctcgcccggcctgccagcgctgctctccgccgcagcttcagcacctcg
gcccagaacaatgctaaagtagctgtgctaggggcctctggaggcatcgggcagccactt
tcacttctcctgaagaacagccccttggtgagccgcctgaccctctatgatatcgcgcac
acacccggagtggccgcagatctgagccacatcgagaccaaagccgctgtgaaaggctac
ctcggacctgaacagctgcctgactgcctgaaaggttgtgatgtggtagttattccggct
ggagtccccagaaagccaggcatgacccgggacgacctgttcaacaccaatgccacgatt
gtggccaccctgaccgctgcctgtgcccagcactgcccggaagccatgatctgcgtcatt
gccaatccggttaattccaccatccccatcacagcagaagttttcaagaagcatggagtg
tacaaccccaacaaaatcttcggcgtgacgaccctggacatcgtcagagccaacaccttt
gttgcagagctgaagggtttggatccagctcgagtcaacgtccctgtcattggtggccat
gctgggaagaccatcatccccctgatctctcagtgcacccccaaggtggactttccccag
gaccagctgacagcactcactgggcggatccaggaggccggcacggaggtggtcaaggct
aaagccggagcaggctctgccaccctctccatggcgtatgccggcgcccgctttgtcttc
tcccttgtggatgcaatgaatggaaaggaaggtgttgtggaatgttccttcgttaagtca
caggaaacggaatgtacctacttctccacaccgctgctgcttgggaaaaagggcatcgag
aagaacctgggcatcggcaaagtctcctcttttgaggagaagatgatctcggatgccatc
cccgagctgaaggcctccatcaagaagggggaagatttcgtgaagaccctgaagtga

DBGET integrated database retrieval system