KEGG   Homo sapiens (human): 4191Help
Entry
4191              CDS       T01001                                 

Gene name
MDH2, EIEE51, M-MDH, MDH, MGC:3559, MOR1
Definition
(RefSeq) malate dehydrogenase 2
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4191 (MDH2)
   00620 Pyruvate metabolism
    4191 (MDH2)
   00630 Glyoxylate and dicarboxylate metabolism
    4191 (MDH2)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4191 (MDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     4191 (MDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Semialdhyde_dh NAD_binding_10 3Beta_HSD THF_DHG_CYH_C DapB_N
Motif
Other DBs
NCBI-GeneID: 4191
NCBI-ProteinID: NP_005909
OMIM: 154100
HGNC: 6971
Ensembl: ENSG00000146701
Vega: OTTHUMG00000023827
Pharos: P40926(Tchem)
UniProt: P40926 A0A024R4K3 B3KTM1
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 338 aa AA seqDB search
MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA
KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE
KNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgccctcgcccggcctgccagcgctgctctccgccgcagcttcagcacctcg
gcccagaacaatgctaaagtagctgtgctaggggcctctggaggcatcgggcagccactt
tcacttctcctgaagaacagccccttggtgagccgcctgaccctctatgatatcgcgcac
acacccggagtggccgcagatctgagccacatcgagaccaaagccgctgtgaaaggctac
ctcggacctgaacagctgcctgactgcctgaaaggttgtgatgtggtagttattccggct
ggagtccccagaaagccaggcatgacccgggacgacctgttcaacaccaatgccacgatt
gtggccaccctgaccgctgcctgtgcccagcactgcccggaagccatgatctgcgtcatt
gccaatccggttaattccaccatccccatcacagcagaagttttcaagaagcatggagtg
tacaaccccaacaaaatcttcggcgtgacgaccctggacatcgtcagagccaacaccttt
gttgcagagctgaagggtttggatccagctcgagtcaacgtccctgtcattggtggccat
gctgggaagaccatcatccccctgatctctcagtgcacccccaaggtggactttccccag
gaccagctgacagcactcactgggcggatccaggaggccggcacggaggtggtcaaggct
aaagccggagcaggctctgccaccctctccatggcgtatgccggcgcccgctttgtcttc
tcccttgtggatgcaatgaatggaaaggaaggtgttgtggaatgttccttcgttaagtca
caggaaacggaatgtacctacttctccacaccgctgctgcttgggaaaaagggcatcgag
aagaacctgggcatcggcaaagtctcctcttttgaggagaagatgatctcggatgccatc
cccgagctgaaggcctccatcaagaagggggaagatttcgtgaagaccctgaagtga

DBGET integrated database retrieval system