KEGG   Homo sapiens (human): 4194Help
Entry
4194              CDS       T01001                                 

Gene name
MDM4, HDMX, MDMX, MRP1
Definition
MDM4, p53 regulator
Orthology
K10127  
protein Mdm4
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    4194 (MDM4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4194 (MDM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 440 aa AA seqDB search
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQVIEVGKNDDLEDSKSL
SDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIP
EKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSM
GEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKA
GASCPICKKEIQLVIKVFIA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattttccacctctgctcagtgttcaacatctgacagtgcttgcaggatctct
cctggacaaatcaatcaggtacgaccaaaactgccgcttttgaagattttgcatgcagca
ggtgcgcaaggtgaaatgttcactgttaaagaggtcatgcactatttaggtcagtacata
atggtgaagcaactttatgatcagcaggagcagcatatggtatattgtggtggagatctt
ttgggagaactactgggacgtcagagcttctccgtgaaagacccaagccctctctatgat
atgctaagaaagaatcttgtcactttagccactgctactacagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagtcaagaccaactgaagcaaagtgca
gaggaaagttccacttccagaaaaagaactacagaagacgatatccccacactgcctacc
tcagagcataaatgcatacattctagagaagatgaagacttaattgaaaatttagcccaa
gatgaaacatctaggctggaccttggatttgaggagtgggatgtagctggcctgccttgg
tggtttttaggaaacttgagaagcaactatacacctagaagtaatggctcaactgattta
cagacaaatcaggtgattgaagtgggaaaaaatgatgacctggaggactctaagtcctta
agtgatgataccgatgtagaggttacctctgaggatgagtggcagtgtactgaatgcaag
aaatttaactctccaagcaagaggtactgttttcgttgttgggccttgaggaaggattgg
tattcagattgttcaaagttaacccattctctctccacgtctgatatcactgccatacct
gaaaaggaaaatgaaggaaatgatgtccctgattgtcgaagaaccatttcggctcctgtc
gttagacctaaagatgcgtatataaagaaagaaaactccaaactttttgatccctgcaac
tcagtggaattcttggatttggctcacagttctgaaagccaagagaccatctcaagcatg
ggagaacagttagataacctttctgaacagagaacagatacagaaaacatggaggattgc
cagaatctcttgaagccatgtagcttatgtgagaaaagaccacgagacgggaacattatt
catggaaggacgggccatcttgtcacttgttttcactgtgccagaagactaaagaaggct
ggggcttcatgccctatttgcaagaaagagattcagctggttattaaggtttttatagca
taa

DBGET integrated database retrieval system