KEGG   Homo sapiens (human): 4194Help
Entry
4194              CDS       T01001                                 

Gene name
MDM4, HDMX, MDMX, MRP1
Definition
(RefSeq) MDM4, p53 regulator
  KO
K10127  
protein Mdm4
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
MicroRNAs in cancer
Disease
H01513  
Retinoblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    4194 (MDM4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4194 (MDM4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    4194 (MDM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 490 aa AA seqDB search
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF
LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTS
EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP
DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
IQLVIKVFIA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattttccacctctgctcagtgttcaacatctgacagtgcttgcaggatctct
cctggacaaatcaatcaggtacgaccaaaactgccgcttttgaagattttgcatgcagca
ggtgcgcaaggtgaaatgttcactgttaaagaggtcatgcactatttaggtcagtacata
atggtgaagcaactttatgatcagcaggagcagcatatggtatattgtggtggagatctt
ttgggagaactactgggacgtcagagcttctccgtgaaagacccaagccctctctatgat
atgctaagaaagaatcttgtcactttagccactgctactacagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagtcaagaccaactgaagcaaagtgca
gaggaaagttccacttccagaaaaagaactacagaagacgatatccccacactgcctacc
tcagagcataaatgcatacattctagagaagatgaagacttaattgaaaatttagcccaa
gatgaaacatctaggctggaccttggatttgaggagtgggatgtagctggcctgccttgg
tggtttttaggaaacttgagaagcaactatacacctagaagtaatggctcaactgattta
cagacaaatcaggatgtgggtactgccattgtttcagatactacagatgacttgtggttt
ttgaatgagtcagtatcagagcagttaggtgttggaataaaagttgaagctgctgatact
gaacaaacaagtgaagaagtagggaaagtaagtgacaaaaaggtgattgaagtgggaaaa
aatgatgacctggaggactctaagtccttaagtgatgataccgatgtagaggttacctct
gaggatgagtggcagtgtactgaatgcaagaaatttaactctccaagcaagaggtactgt
tttcgttgttgggccttgaggaaggattggtattcagattgttcaaagttaacccattct
ctctccacgtctgatatcactgccatacctgaaaaggaaaatgaaggaaatgatgtccct
gattgtcgaagaaccatttcggctcctgtcgttagacctaaagatgcgtatataaagaaa
gaaaactccaaactttttgatccctgcaactcagtggaattcttggatttggctcacagt
tctgaaagccaagagaccatctcaagcatgggagaacagttagataacctttctgaacag
agaacagatacagaaaacatggaggattgccagaatctcttgaagccatgtagcttatgt
gagaaaagaccacgagacgggaacattattcatggaaggacgggccatcttgtcacttgt
tttcactgtgccagaagactaaagaaggctggggcttcatgccctatttgcaagaaagag
attcagctggttattaaggtttttatagcataa

DBGET integrated database retrieval system