KEGG   Homo sapiens (human): 4199Help
Entry
4199              CDS       T01001                                 

Gene name
ME1, HUMNDME, MES
Definition
(RefSeq) malic enzyme 1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    4199 (ME1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4199 (ME1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4199 (ME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic Trimer_CC
Motif
Other DBs
NCBI-GeneID: 4199
NCBI-ProteinID: NP_002386
OMIM: 154250
HGNC: 6983
Ensembl: ENSG00000065833
Vega: OTTHUMG00000015111
Pharos: P48163(Tchem)
UniProt: P48163
Structure
PDB: 

Jmol
Position
6q14.2
AA seq 572 aa AA seqDB search
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK
NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP
RGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
GGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNC
LIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEE
MKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLT
TAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFV
RSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgaagccccccgtcgccgccacacccatcagcgcggctacctgctgacacgg
aaccctcacctcaacaaggacttggcctttaccctggaagagagacagcaattgaacatt
catggattgttgccaccttccttcaacagtcaggagatccaggttcttagagtagtaaaa
aatttcgagcatctgaactctgactttgacaggtatcttctcttaatggatctccaagat
agaaatgaaaaactcttttatagagtgctgacatctgacattgagaaattcatgcctatt
gtttatactcccactgtgggtctggcttgccaacaatatagtttggtgtttcggaagcca
agaggtctctttattactatccacgatcgagggcatattgcttcagttctcaatgcatgg
ccagaagatgtcatcaaggccattgtggtgactgatggagagcgtattcttggcttggga
gaccttggctgtaatggaatgggcatccctgtgggtaaattggctctatatacagcttgc
ggagggatgaatcctcaagaatgtctgcctgtcattctggatgtgggaaccgaaaatgag
gagttacttaaagatccactctacattggactacggcagagaagagtaagaggttctgaa
tatgatgattttttggacgaattcatggaggcagtttcttccaagtatggcatgaattgc
cttattcagtttgaagattttgccaatgtgaatgcatttcgtctcctgaacaagtatcga
aaccagtattgcacattcaatgatgatattcaaggaacagcatctgttgcagttgcaggt
ctccttgcagctcttcgaataaccaagaacaaactgtctgatcaaacaatactattccaa
ggagctggagaggctgccctagggattgcacacctgattgtgatggccttggaaaaagaa
ggtttaccaaaagagaaagccatcaaaaagatatggctggttgattcaaaaggattaata
gttaagggacgtgcttccttaacacaagagaaagagaagtttgcccatgaacatgaagaa
atgaagaacctagaagccattgttcaagaaataaaaccaactgccctcataggagttgct
gcaattggtggtgcattctcagaacaaattctcaaagatatggctgccttcaatgaacgg
cctattatttttgctttgagtaatccaactagcaaagcagaatgttctgcagagcagtgc
tacaaaataaccaagggacgtgcaatttttgccagtggcagtccttttgatccagtcact
cttccaaatggacagaccctatatcctggccaaggcaacaattcctatgtgttccctgga
gttgctcttggtgttgtggcgtgtggattgaggcagatcacagataatattttcctcact
actgctgaggttatagctcagcaagtgtcagataaacacttggaagagggtcggctttat
cctcctttgaataccattagagatgtttctctgaaaattgcagaaaagattgtgaaagat
gcataccaagaaaagacagccacagtttatcctgaaccgcaaaacaaagaagcatttgtc
cgctcccagatgtatagtactgattatgaccagattctacctgattgttattcttggcct
gaagaggtgcagaaaatacagaccaaagttgaccagtag

DBGET integrated database retrieval system