KEGG   Homo sapiens (human): 4199Help
Entry
4199              CDS       T01001                                 

Gene name
ME1, HUMNDME, MES
Definition
malic enzyme 1, NADP(+)-dependent, cytosolic (EC:1.1.1.40)
Orthology
K00029  
malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4199 (ME1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    4199 (ME1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4199 (ME1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4199 (ME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q12
AA seq 572 aa AA seqDB search
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK
NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP
RGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
GGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNC
LIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEE
MKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLT
TAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFV
RSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgaagccccccgtcgccgccacacccatcagcgcggctacctgctgacacgg
aaccctcacctcaacaaggacttggcctttaccctggaagagagacagcaattgaacatt
catggattgttgccaccttccttcaacagtcaggagatccaggttcttagagtagtaaaa
aatttcgagcatctgaactctgactttgacaggtatcttctcttaatggatctccaagat
agaaatgaaaaactcttttatagagtgctgacatctgacattgagaaattcatgcctatt
gtttatactcccactgtgggtctggcttgccaacaatatagtttggtgtttcggaagcca
agaggtctctttattactatccacgatcgagggcatattgcttcagttctcaatgcatgg
ccagaagatgtcatcaaggccattgtggtgactgatggagagcgtattcttggcttggga
gaccttggctgtaatggaatgggcatccctgtgggtaaattggctctatatacagcttgc
ggagggatgaatcctcaagaatgtctgcctgtcattctggatgtgggaaccgaaaatgag
gagttacttaaagatccactctacattggactacggcagagaagagtaagaggttctgaa
tatgatgattttttggacgaattcatggaggcagtttcttccaagtatggcatgaattgc
cttattcagtttgaagattttgccaatgtgaatgcatttcgtctcctgaacaagtatcga
aaccagtattgcacattcaatgatgatattcaaggaacagcatctgttgcagttgcaggt
ctccttgcagctcttcgaataaccaagaacaaactgtctgatcaaacaatactattccaa
ggagctggagaggctgccctagggattgcacacctgattgtgatggccttggaaaaagaa
ggtttaccaaaagagaaagccatcaaaaagatatggctggttgattcaaaaggattaata
gttaagggacgtgcttccttaacacaagagaaagagaagtttgcccatgaacatgaagaa
atgaagaacctagaagccattgttcaagaaataaaaccaactgccctcataggagttgct
gcaattggtggtgcattctcagaacaaattctcaaagatatggctgccttcaatgaacgg
cctattatttttgctttgagtaatccaactagcaaagcagaatgttctgcagagcagtgc
tacaaaataaccaagggacgtgcaatttttgccagtggcagtccttttgatccagtcact
cttccaaatggacagaccctatatcctggccaaggcaacaattcctatgtgttccctgga
gttgctcttggtgttgtggcgtgtggattgaggcagatcacagataatattttcctcact
actgctgaggttatagctcagcaagtgtcagataaacacttggaagagggtcggctttat
cctcctttgaataccattagagatgtttctctgaaaattgcagaaaagattgtgaaagat
gcataccaagaaaagacagccacagtttatcctgaaccgcaaaacaaagaagcatttgtc
cgctcccagatgtatagtactgattatgaccagattctacctgattgttattcttggcct
gaagaggtgcagaaaatacagaccaaagttgaccagtag

DBGET integrated database retrieval system