KEGG   Homo sapiens (human): 420Help
Entry
420               CDS       T01001                                 

Gene name
ART4, ARTC4, CD297, DO, DOK1
Definition
ADP-ribosyltransferase 4 (Dombrock blood group) (EC:2.4.2.31)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     420 (ART4)
Cellular antigens [BR:hsa04090]
 Proteins
  420 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
12p13-p12
AA seq 314 aa AA seqDB search
MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPG
SFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHA
VAILFYTLNSNVHSDFTRAMASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGT
LCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFS
LKKEVLIPPYELFKVINMSYHPRGDWLQLRSTGNLSTYNCQLLKASSKKCIPDPIAIASL
SFLTSVIIFSKSRV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggtccattgatcaacagatgcaagaagattcttctcccaactactgtacctcctgca
acgatgagaatctggctccttggaggcctgctgccattcctgctgctcctctctggcctg
cagagacccacagagggttctgaggttgcaattaaaatcgacttcgacttcgcaccaggt
tcttttgatgatcagtaccaaggctgtagcaaacaggttatggagaaactaactcaaggg
gattatttcacaaaagacatagaagcccagaagaattattttaggatgtggcaaaaagcc
cacttagcctggcttaaccaaggaaaagttctaccccagaacatgactaccacacacgct
gtggctattttgttttatacattgaacagcaatgttcattctgactttactagagccatg
gcctctgttgccaggactccacagcagtatgaacgttcattccacttcaaatatttacac
tactacctcacctcagcaatccagctgctgaggaaagacagcatcatggagaatggcact
ctgtgctatgaggtgcattataggacgaaggatgtccactttaatgcctacacaggggcc
accattcgatttggccaattcctctccacatccctcctgaaagaagaggcacaggagttt
gggaaccagacactatttaccatattcacctgcctgggtgcacctgtacagtacttctcc
ctcaagaaggaagtcttgatccctccctatgagctgtttaaagttataaatatgagctac
cacccaagaggagactggttgcagttgaggtcaactgggaacctgagcacatataactgt
cagctgctaaaagcttccagcaagaaatgcatccctgatcctatagctattgcatctctc
tcctttttgaccagtgtcatcatcttttccaaaagcagagtataa

DBGET integrated database retrieval system