KEGG   Homo sapiens (human): 4200Help
Entry
4200              CDS       T01001                                 

Gene name
ME2, ODS1
Definition
malic enzyme 2, NAD(+)-dependent, mitochondrial (EC:1.1.1.38)
Orthology
K00027  
malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
hsa  Homo sapiens (human)
Pathway
Pyruvate metabolism
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4200 (ME2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    4200 (ME2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     4200 (ME2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21
AA seq 479 aa AA seqDB search
MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC
SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP
VGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMK
AITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISK
PISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDS
YQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS
NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccggttaagagtagtttccaccacttgtactttggcatgtcgacatttgcac
ataaaagaaaaaggcaagccacttatgctgaacccaagaacaaacaagggaatggcattt
actttacaagaacgacaaatgcttggtcttcaaggacttctacctcccaaaatagagaca
caagatattcaagccttacgatttcatagaaacttgaagaaaatgactagccctttggaa
aaatatatctacataatgggaatacaagaaagaaatgagaaattgttttatagaatactg
caagatgacattgagagtttaatgccaattgtatatacaccgacggttggtcttgcctgc
tcccagtatggacacatctttagaagacctaagggattatttatttcgatctcagacaga
ggtcatgttagatcaattgtggataactggccagaaaatcatgttaaggctgttgtagtg
actgatggagagagaattctgggtcttggagatctgggtgtctatggaatgggaattcca
gtaggaaaactttgtttgtatacagcttgtgcaggaatacggcctgatagatgcctgcca
gtgtgtattgatgtgggaactgataatatcgcactcttaaaagacccattttacatgggc
ttgtaccagaaacgagatcgcacacaacagtatgatgacctgattgatgagtttatgaaa
gctattactgacagatatggccggaacacactcattcagttcgaagactttggaaatcat
aatgcattcaggttcttgagaaagtaccgagaaaaatattgtactttcaatgatgatatt
caagggacagctgcagtagctctagcaggtcttcttgcagcacaaaaagttattagtaaa
ccaatctccgaacacaaaatcttattccttggagcaggagaggctgctcttggaattgca
aatcttatagttatgtctatggtagaaaatggcctgtcagaacaagaggcacaaaagaaa
atctggatgtttgacaagtatggtttattagttaagggacggaaagcaaaaatagatagt
tatcaggaaccatttactcactcagccccagagagcatacctgatacttttgaagatgca
gtgaatatactgaagccttcaactataattggagttgcaggtgctggccgtcttttcact
cctgatgtaatcagagccatggcctctatcaatgaaaggcctgtaatatttgcattaagt
aatcctacagcacaggcagagtgcacggctgaagaagcatatacacttacagagggcagg
tgtttgtttgccagtggcagtccatttgggccagtgaaacttacagatgggcgagtcttt
acaccaggtcaaggaaacaatgtttatatttttccaggttacagaatacctatatgctaa

DBGET integrated database retrieval system