KEGG   Homo sapiens (human): 4205Help
Entry
4205              CDS       T01001                                 

Gene name
MEF2A, ADCAD1, RSRFC4, RSRFC9, mef2
Definition
(RefSeq) myocyte enhancer factor 2A
  KO
K09260  
MADS-box transcription enhancer factor 2A
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    4205 (MEF2A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    4205 (MEF2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26
AA seq 505 aa AA seqDB search
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNE
DSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSP
PQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGAT
GANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQRIS
SSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLSLG
QVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQQQ
QQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIV
LGRPPNTEDRESPSVKRMRMDAWVT
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggggcggaagaaaatacaaatcacacgcataatggatgaaaggaaccgacaggtcact
tttacaaagagaaagtttggattaatgaagaaagcctatgaacttagtgtgctctgtgac
tgtgaaatagcactcatcattttcaacagctctaacaaactgtttcaatatgctagcact
gatatggacaaagttcttctcaagtatacagaatataatgaacctcatgaaagcagaacc
aactcggatattgttgagactttaagaaagaaaggccttaatggttgtgagagccctgat
gctgacgattactttgagcacagtccactctcggaggacagattcagcaaactaaatgaa
gatagtgattttattttcaaacgaggccctcctggtctgccacctcagaacttttcaatg
tctgtcacagttccagtgaccagccccaatgctttgtcctacactaacccagggagttca
ctggtgtccccatctttggcagccagctcaacgttaacagattcaagcatgctctctcca
cctcaaaccacattacatagaaatgtgtctcctggagctcctcagagaccaccaagtact
ggcaatgcaggtgggatgttgagcactacagacctcacagtgccaaatggagctggaagc
agtccagtggggaatggatttgtaaactcaagagcttctccaaatttgattggagctact
ggtgcaaatagcttaggcaaagtcatgcctacaaagtctccccctccaccaggtggtggt
aatcttggaatgaacagtaggaaaccagatcttcgagttgtcatccccccttcaagcaag
ggcatgatgcctccactatcggaggaagaggaattggagttgaatacccagaggatcagt
agttctcaagccactcaacctcttgctaccccagtcgtgtctgtgacaaccccaagcttg
cctccgcaaggacttgtgtactcagcaatgccgactgcctacaacactgattattcactg
accagcgctgacctgtcagcccttcaaggcttcaactcgccaggaatgctgtcgctggga
caggtgtcggcctggcagcagcaccacctaggacaagcagccctcagctctcttgttgct
ggagggcagttatctcagggttccaatttatccattaataccaaccaaaacatcagcatc
aagtccgaaccgatttcacctcctcgggatcgtatgaccccatcgggcttccagcagcag
cagcagcagcagcagcagcagcagccgccgccaccaccgcagccccagccacaacccccg
cagccccagccccgacaggaaatggggcgctcccctgtggacagtctgagcagctctagt
agctcctatgatggcagtgatcgggaggatccacggggcgacttccattctccaattgtg
cttggccgacccccaaacactgaggacagagaaagcccttctgtaaagcgaatgaggatg
gacgcgtgggtgacctaa

DBGET integrated database retrieval system