KEGG   Homo sapiens (human): 4208Help
Entry
4208              CDS       T01001                                 

Gene name
MEF2C, C5DELq14.3, DEL5q14.3
Definition
myocyte enhancer factor 2C
Orthology
K04454  
MADS-box transcription enhancer factor 2C
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oxytocin signaling pathway
Transcriptional misregulation in cancer
Disease
H01223  
Mental retardation-stereotypic movements-epilepsy and/or cerebral malformations (MRSME)
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q14.3
AA seq 463 aa AA seqDB search
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGCESPDPDSSYALTPRTEEKYKKINE
EFDNMIKSHKIPAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSM
SPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPP
PMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQSLATPVVSVATPTLPGQGMGG
YPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACT
STHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSS
YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacgaggattatggatgaacgtaacagacaggtgaca
tttacaaagaggaaatttgggttgatgaagaaggcttatgagctgagcgtgctgtgtgac
tgtgagattgcgctgatcatcttcaacagcaccaacaagctgttccagtatgccagcacc
gacatggacaaagtgcttctcaagtacacggagtacaacgagccgcatgagagccggaca
aactcagacatcgtggaggcattgaacaagaaagaaaacaaaggctgtgaaagccccgat
cccgactcctcttatgcactcaccccacgcactgaagaaaaatacaaaaaaattaatgaa
gaatttgataatatgatcaagagtcataaaattcctgctgttccacctcccaacttcgag
atgccagtctccatcccagtgtccagccacaacagtttggtgtacagcaaccctgtcagc
tcactgggaaaccccaacctattgccactggctcacccttctctgcagaggaatagtatg
tctcctggtgtaacacatcgacctccaagtgcaggtaacacaggtggtctgatgggtgga
gacctcacgtctggtgcaggcaccagtgcagggaacgggtatggcaatccccgaaactca
ccaggtctgctggtctcacctggtaacttgaacaagaatatgcaagcaaaatctcctccc
ccaatgaatttaggaatgaataaccgtaaaccagatctccgagttcttattccaccaggc
agcaagaatacgatgccatcagtgaatcaaaggataaataactcccagtcggctcagtca
ttggctaccccagtggtttccgtagcaactcctactttaccaggacaaggaatgggagga
tatccatcagccatttcaacaacatatggtaccgagtactctctgagtagtgcagacctg
tcatctctgtctgggtttaacaccgccagcgctcttcaccttggttcagtaactggctgg
caacagcaacacctacataacatgccaccatctgccctcagtcagttgggagcttgcact
agcactcatttatctcagagttcaaatctctccctgccttctactcaaagcctcaacatc
aagtcagaacctgtttctcctcctagagaccgtaccaccaccccttcgagatacccacaa
cacacgcgccacgaggcggggagatctcctgttgacagcttgagcagctgtagcagttcg
tacgacgggagcgaccgagaggatcaccggaacgaattccactcccccattggactcacc
agaccttcgccggacgaaagggaaagtccctcagtcaagcgcatgcgactttctgaagga
tgggcaacatga

DBGET integrated database retrieval system