KEGG   Homo sapiens (human): 4209Help
Entry
4209              CDS       T01001                                 

Gene name
MEF2D
Definition
(RefSeq) myocyte enhancer factor 2D
  KO
K09262  
MADS-box transcription enhancer factor 2D
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    4209 (MEF2D)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    4209 (MEF2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q12-q23
AA seq 521 aa AA seqDB search
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
VTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYET
GDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggggaggaaaaagattcagatccagcgaatcaccgacgagcggaaccgacaggtgact
ttcaccaagcggaagtttggcctgatgaagaaggcgtatgagctgagcgtgctatgtgac
tgcgagatcgcactcatcatcttcaaccactccaacaagctgttccagtacgccagcacc
gacatggacaaggtgctgctcaagtacacggagtacaatgagccacacgagagccgcacc
aacgccgacatcatcgagaccctgaggaagaagggcttcaacggctgcgacagccccgag
cccgacggggaggactcgctggaacagagccccctgctggaggacaagtaccgacgcgcc
agcgaggagctcgacgggctcttccggcgctatgggtcaactgtcccggcccccaacttt
gccatgcctgtcacggtgcccgtgtccaatcagagctcactgcagttcagcaatcccagc
ggctccctggtcaccccttccctggtgacatcatccctcacggacccgcggctcctgtcc
ccccagcagccagcactacagaggaacagtgtgtctcctggcctgccccagcggccagct
agtgcgggggccatgctggggggtgacctgaacagtgctaacggagcctgccccagccct
gttgggaatggctacgtcagtgctcgggcttcccctggcctcctccctgtggccaatggc
aacagcctaaacaaggtcatccctgccaagtctccacccccacctacccacagcacccag
cttggagcccccagccgcaagcccgacctgcgagtcatcacttcccaggcaggaaagggg
ttaatgcatcacttgactgaggaccatttagatctgaacaatgcccagcgccttggggtc
tcccagtctactcattcgctcaccaccccagtggtttctgtggcaacgccgagtttactc
agccagggcctccccttctcttccatgcccactgcctacaacacagattaccagttgacc
agtgcagagctctcctccttaccagcctttagttcacctggggggctgtcgctaggcaat
gtcactgcctggcaacagccacagcagccccagcagccgcagcagccacagcctccacag
cagcagccaccgcagccacagcagccacagccacagcagcctcagcagccgcaacagcca
cctcagcaacagtcccacctggtccctgtatctctcagcaacctcatcccgggcagcccc
ctgccccacgtgggtgctgccctcacagtcaccacccacccccacatcagcatcaagtca
gaaccggtgtccccaagccgtgagcgcagccctgcgcctccccctccagctgtgttccca
gctgcccgccctgagcctggcgatggtctcagcagcccagccgggggatcctatgagacg
ggagaccgggatgacggacggggggacttcgggcccacactgggcctgctgcgcccagcc
ccagagcctgaggctgagggctcagctgtgaagaggatgcggcttgatacctggacatta
aagtga

DBGET integrated database retrieval system