KEGG   Homo sapiens (human): 4214Help
Entry
4214              CDS       T01001                                 

Gene name
MAP3K1, MAPKKK1, MEKK, MEKK_1, MEKK1, SRXY6
Definition
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase (EC:2.7.11.25)
Orthology
K04416  
mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ubiquitin mediated proteolysis
RIG-I-like receptor signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Hepatitis B
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4214 (MAP3K1)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4214 (MAP3K1)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    4214 (MAP3K1)
  Endocrine system
   04912 GnRH signaling pathway
    4214 (MAP3K1)
  Nervous system
   04722 Neurotrophin signaling pathway
    4214 (MAP3K1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4214 (MAP3K1)
   05161 Hepatitis B
    4214 (MAP3K1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4214 (MAP3K1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   4214 (MAP3K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
5q11.2
AA seq 1512 aa AA seqDB search
MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLTESVAAPDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEVQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFN
LTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANG
ESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLRA
MLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVG
REILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTD
VSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENS
SPECTVHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKG
RPHSQCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQ
TQRKFSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNS
MTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASM
PSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQD
ALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYN
LFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDST
GQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAII
EMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSR
ELLKHPVFRTTW
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccagggctacg
agccctgaggcaggcggcggcggaggagccctcaaggcgagcagcgcgcccgcggctgcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagcagccgctcttcctt
gccgcctcaccgccggcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccttaccgagtcggtggcggcgccggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccgtctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggatgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttagcagctgagtctccaggagaggtccaggcaagtgcg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaaccgccgtgttaacaaagtgatgcgggccagactgtacttactgcag
cagatagggcctaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtgcacgtggaacattctgtattcatctgctattt
gtgatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacgtctagttcagaaaacagcataaaggatgaagaggaa
cagatgtgtcctatttgcttgttgggcatgcttgatgaagaaagtcttacagtgtgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggagatctcatgatttc
tacagccacgagttgtcaagtcctgtggattccccttcttccctcagagctgcacagcag
caaaccgtacagcagcagcctttggctggatcacgaaggaatcaagagagcaattttaac
cttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagccatgg
attcaggtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtgaga
gagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaatggg
gagagcactggaaattctgggggcagcagtggaagcagcccgagtgggggagccaccagt
gggtcttcccagaccagtatctcaggagatgtggtggaggcatgctgcagcgttctgtca
atggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgagagcc
atgctggtatatactccttgccacagtttagcggaaagaatcaaacttcagagacttctc
cagccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagtcag
ctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcagttggc
agagaaatactaaaagctggatccattggtattggtggtgttgattatgtcttaaattgt
attcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgtctt
atagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtactgat
gtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaaccttt
gctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatctac
ttgagttctgcaagaatggttactacagtaccccatgtgttttcaaaactgttagaaatg
ctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctattgca
gatgaggtggaaattgccgaagccatccagttgggcgtagaagacactttggatggtcaa
caggacagcttcttgcaggcatctgttcccaacaactatctggaaaccacagagaacagt
tcccctgagtgcacagtccatttagagaaaactggaaaaggattatgtgctacaaaattg
agtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttctagt
tcaacaacaacaacaacaacaacaacagagcaaccaaagccaatggttcaaacaaaaggc
agaccccacagtcagtgtttgaactcctctcctttatctcatcattcccaattaatgttt
ccagccttgtcaaccccttcttcttctaccccatctgtaccagctggcactgcaacagat
gtctctaagcatagacttcagggattcattccctgcagaataccttctgcatctcctcaa
acacagcgcaagttttctctacaattccacagaaactgtcctgaaaacaaagactcagat
aaactttccccagtctttactcagtcaagacccttgccctccagtaacatacacaggcca
aagccatctagacctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagc
atgacacttgatctgaacagtagttccaaatgtgatgacagctttggctgtagcagcaat
agtagtaatgctgttatacccagtgacgagacagtgttcaccccagtagaggagaaatgc
agattagatgtcaatacagagctcaactccagtattgaggaccttcttgaagcatctatg
ccttcaagtgatacaacagtaacttttaagtcagaagttgctgtcctgtctcctgaaaag
gctgaaaatgatgatacctacaaagatgatgtgaatcataatcaaaagtgcaaagagaag
atggaagctgaagaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggat
gccctccccatagttcctcagctgcaggttgaaaatggagaagatatcatcattattcaa
caggatacaccagagactctaccaggacataccaaagcaaaacaaccgtatagagaagac
actgaatggctgaaaggtcaacagataggccttggagcattttcttcttgttatcaggct
caagatgtgggaactggaactttaatggctgttaaacaggtgacttatgtcagaaacaca
tcttctgagcaagaagaagtagtagaagcactaagagaagagataagaatgatgagccat
ctgaatcatccaaacatcattaggatgttgggagccacgtgtgagaagagcaattacaat
ctcttcattgaatggatggcagggggatcggtggctcatttgctgagtaaatatggagcc
ttcaaagaatcagtagttattaactacactgaacagttactccgtggcctttcgtatctc
catgaaaaccaaatcattcacagagatgtcaaaggtgccaatttgctaattgacagcact
ggtcagagactaagaattgcagattttggagctgcagccaggttggcatcaaaaggaact
ggtgcaggagagtttcagggacaattactggggacaattgcatttatggcacctgaggta
ctaagaggtcaacagtatggaaggagctgtgatgtatggagtgttggctgtgctattata
gaaatggcttgtgcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttg
atatttaagattgctagtgcaactactgctccatcgatcccttcacatttgtctcctggt
ttacgagatgtggctcttcgttgtttagaacttcaacctcaggacagacctccatcaaga
gagctactgaagcatccagtctttcgtactacatggtag

DBGET integrated database retrieval system