KEGG   Homo sapiens (human): 4215Help
Entry
4215              CDS       T01001                                 

Gene name
MAP3K3, MAPKKK3, MEKK3
Definition
mitogen-activated protein kinase kinase kinase 3 (EC:2.7.11.25)
Orthology
K04421  
mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4215 (MAP3K3)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    4215 (MAP3K3)
  Nervous system
   04722 Neurotrophin signaling pathway
    4215 (MAP3K3)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4215 (MAP3K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4215 (MAP3K3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   4215 (MAP3K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 626 aa AA seqDB search
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacaggtcactcaaat
aggcagagtgacgtcagaatcaagttcgagcacaacggggagaggcgaattatagcgttc
agccggcctgtgaaatatgaagatgtggagcacaaggtgacaacagtatttggacaacct
cttgatctacattacatgaacaatgagctctccatcctgctgaaaaaccaagatgatctt
gataaagcaattgacattttagatagaagctcaagcatgaaaagccttaggatattgctg
ttgtcccaggacagaaaccataacagttcctctccccactctggggtgtccagacaggtg
cggatcaaggcttcccagtccgcaggggatataaatactatctaccagccccccgagccc
agaagcaggcacctctctgtcagctcccagaaccctggccgaagctcacctccccctggc
tatgttcctgagcggcagcagcacattgcccggcaggggtcctacaccagcatcaacagt
gagggggagttcatcccagagaccagcgagcagtgcatgctggatcccctgagcagtgca
gaaaattccttgtctggaagctgccaatccttggacaggtcagcagacagcccatccttc
cggaaatcacgaatgtcccgtgcccagagcttccctgacaacagacaggaatactcagat
cgggaaactcagctttatgacaaaggggtcaaaggtggaacctacccccggcgctaccac
gtgtctgtgcaccacaaggactacagtgatggcagaagaacatttccccgaatacggcgt
catcaaggcaacttgttcaccctggtgccctccagccgctccctgagcacaaatggcgag
aacatgggtctggctgtgcaatacctggacccccgtgggcgcctgcggagtgcggacagc
gagaatgccctctctgtgcaggagaggaatgtgccaaccaagtctcccagtgcccccatc
aactggcgccggggaaagctcctgggccagggtgccttcggcagggtctatttgtgctat
gacgtggacacgggacgtgaacttgcttccaagcaggtccaatttgatccagacagtcct
gagacaagcaaggaggtgagtgctctggagtgcgagatccagttgctaaagaacttgcag
catgagcgcatcgtgcagtactatggctgtctgcgggaccgcgctgagaagaccctgacc
atcttcatggagtacatgccagggggctcggtgaaagaccagttgaaggcttacggtgct
ctgacagagagcgtgacccgaaagtacacgcggcagatcctggagggcatgtcctacctg
cacagcaacatgattgttcaccgggacattaagggagccaacatcctccgagactctgct
gggaatgtaaagctgggggactttggggccagcaaacgcctgcagacgatctgtatgtcg
gggacgggcatgcgctccgtcactggcacaccctactggatgagccctgaggtgatcagc
ggcgagggctatggaaggaaagcagacgtgtggagcctgggctgcactgtggtggagatg
ctgacagagaaaccaccgtgggcagagtatgaagctatggccgccatcttcaagattgcc
acccagcccaccaatcctcagctgccctcccacatctctgaacatggccgggacttcctg
aggcgcatttttgtggaggctcgccagagaccttcagctgaggagctgctcacacaccac
tttgcacagctcatgtactga

DBGET integrated database retrieval system