KEGG   Homo sapiens (human): 4216Help
Entry
4216              CDS       T01001                                 

Gene name
MAP3K4, MAPKKK4, MEKK4, MTK1, PRO0412
Definition
mitogen-activated protein kinase kinase kinase 4 (EC:2.7.11.25)
Orthology
K04428  
mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4216 (MAP3K4)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    4216 (MAP3K4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4216 (MAP3K4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   4216 (MAP3K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q26
AA seq 1608 aa AA seqDB search
MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSA
CKSPESDLEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAP
NQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDHKKNVQCSFMLDSVGGSLPKKSIP
DVDLNKPYLSLGCSNAKLPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSK
KKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILT
FKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMEL
LEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDN
SFDIQSRDCISKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLR
KLILRLHKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVS
WEELKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLK
GGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASH
SLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTS
ADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAY
LLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRK
AFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEV
DESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTK
CESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGL
YLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAV
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQ
VCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPND
HKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVI
RLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVN
STLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGM
GHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgctgccgcgctggtccctcctcccgcctttgccgtcacgcctgccgcc
gccatggaggagccgccgccaccgccgccgccgccaccaccgccaccggaacccgagacc
gagtcagaacccgagtgctgcttggcggcgaggcaagagggcacattgggagattcagct
tgcaagagtcctgaatctgatctagaagacttctccgatgaaacaaatacagagaatctt
tatggtacctctccccccagcacacctcgacagatgaaacgcatgtcaaccaaacatcag
aggaataatgtggggaggccagccagtcggtctaatttgaaagaaaaaatgaatgcacca
aatcagcctccacataaagacactggaaaaacagtggagaatgtggaagaatacagctat
aagcaggagaaaaagatccgagcagctcttagaacaacagagcgtgatcataaaaaaaat
gtacagtgctcattcatgttagactcagtgggtggatctttgccaaaaaaatcaattcca
gatgtggatctcaataagccttacctcagccttggctgtagcaatgctaagcttccagta
tctgtgcccatgcctatagccagacctgcacgccagacttctaggactgactgtccagca
gatcgtttaaagttttttgaaactttacgacttttgctaaagcttacctcagtctcaaag
aaaaaagacagggagcaaagaggacaagaaaatacgtctggtttctggcttaaccgatct
aacgaactgatctggttagagctacaagcctggcatgcaggacggacaattaacgaccag
gacttctttttatatacagcccgtcaagccatcccagatattattaatgaaatccttact
ttcaaagtcgactatgggagcttcgcctttgttagagatagagctggttttaatggtact
tcagtagaagggcagtgcaaagccactcctggaacaaagattgtaggttactcaacacat
catgagcatctccaacgccagagggtctcatttgagcaggtaaaacggataatggagctg
ctagagtacatagaagcactttatccatcattgcaggctcttcagaaggactatgaaaaa
tatgctgcaaaagacttccaggacagggtgcaggcactctgtttgtggttaaacatcaca
aaagacttaaatcagaaattaaggattatgggcactgttttgggcatcaagaatttatca
gacattggctggccagtgtttgaaatcccttcccctcgaccatccaaaggtaatgagccg
gagtatgagggtgatgacacagaaggagaattaaaggagttggaaagtagtacggatgag
agtgaagaagaacaaatctctgatcctagggtaccggaaatcagacagcccatagataac
agcttcgacatccagtcgcgggactgcatatccaagaagcttgagaggctcgaatctgag
gatgattctcttggctggggagcaccagactggagcacagaagcaggctttagtagacat
tgtctgacttctatttatagaccatttgtagacaaagcactgaagcagatggggttaaga
aagttaattttaagacttcacaagctaatggatggttccttgcaaagggcacgtatagca
ttggtaaagaacgatcgtccagtggagttttctgaatttccagatcccatgtggggttca
gattatgtgcagttgtcaaggacaccaccttcatctgaggagaaatgcagtgctgtgtcg
tgggaggagctgaaggccatggatttaccttcattcgaacctgccttcctagttctctgc
cgagtccttctgaatgtcatacatgagtgtctgaagttaagattggagcagagacctgct
ggagaaccatctctcttgagtattaagcagctggtgagagagtgtaaggaggtcctgaag
ggcggcctgctgatgaagcagtactaccagttcatgctgcaggaggttctggaggacttg
gagaagcccgactgcaacattgacgcttttgaagaggatctacataaaatgcttatggtg
tattttgattacatgagaagctggatccaaatgctacagcaattacctcaagcatcgcat
agtttaaaaaatctgttagaagaagaatggaatttcaccaaagaaataactcattacata
cggggaggagaagcacaggccgggaagcttttctgtgacattgcaggaatgctgctgaaa
tctacaggaagttttttagaatttggcttacaggagagctgtgctgaattttggactagt
gcggatgacagcagtgcttccgacgaaatcaggaggtctgttatagagatcagtcgagcc
ctgaaggagctcttccatgaagccagagaaagggcttccaaagcacttggatttgctaaa
atgttgagaaaggacctggaaatagcagcagaattcaggctttcagccccagttagagac
ctcctggatgttctgaaatcaaaacagtatgtcaaggtgcaaattcctgggttagaaaac
ttgcaaatgtttgttccagacactcttgctgaggagaagagtattattttgcagttactc
aatgcagctgcaggaaaggactgttcaaaagattcagatgacgtactcatcgatgcctat
ctgcttctgaccaagcacggtgatcgagcccgtgattcagaggacagctggggcacctgg
gaggcacagcctgtcaaagtcgtgcctcaggtggagactgttgacaccctgagaagcatg
caggtggataatcttttactagttgtcatgcagtctgcgcatctcacaattcagagaaaa
gctttccagcagtccattgagggacttatgactctgtgccaggagcagacatccagtcag
ccggtcatcgccaaagctttgcagcagctgaagaatgatgcattggagctatgcaacagg
ataagcaatgccattgaccgcgtggaccacatgttcacatcagaatttgatgctgaggtt
gatgaatctgaatctgtcaccttgcaacagtactaccgagaagcaatgattcaggggtac
aattttggatttgagtatcataaagaagttgttcgtttgatgtctggggagtttagacag
aagataggagacaaatatataagctttgcccggaagtggatgaattatgtcctgactaaa
tgtgagagtggtagaggtacaagacccaggtgggcgactcaaggatttgattttctacaa
gcaattgaacctgcctttatttcagctttaccagaagatgacttcttgagtttacaagcc
ttgatgaatgaatgcattggccatgtcataggaaaaccacacagtcctgttacaggtttg
taccttgccattcatcggaacagcccccgtcctatgaaggtacctcgatgccatagtgac
cctcctaacccacacctcattatccccactccagagggattcagcactcggagcatgcct
tccgacgcgcggagccatggcagccctgctgctgctgctgctgctgctgctgctgctgtt
gctgccagtcggcccagcccctctggtggtgactctgtgctgcccaaatccatcagcagt
gcccatgataccaggggttccagcgttcctgaaaatgatcgattggcttccatagctgct
gaattgcagtttaggtccctgagtcgtcactcaagccccacggaggagcgagatgaacca
gcatatccaagaggagattcaagtgggtccacaagaagaagttgggaacttcggacacta
atcagccagagtaaagatactgcttctaaactaggacccatagaagctatccagaagtca
gtccgattgtttgaagaaaagaggtaccgagaaatgaggagaaagaatatcattggtcaa
gtttgtgatacgcctaagtcctatgataatgttatgcacgttggcttgaggaaggtgacc
ttcaaatggcaaagaggaaacaaaattggagaaggccagtatgggaaggtgtacacctgc
atcagcgtcgacaccggggagctgatggccatgaaagagattcgatttcaacctaatgac
cataagactatcaaggaaactgcagacgaattgaaaatattcgaaggcatcaaacacccc
aatctggttcggtattttggtgtggagctccatagagaagaaatgtacatcttcatggag
tactgcgatgaggggactttagaagaggtgtcaaggctgggacttcaggaacatgtgatt
aggctgtattcaaagcagatcaccattgcgatcaacgtcctccatgagcatggcatagtc
caccgtgacattaaaggtgccaatatcttccttacctcatctggattaatcaaactggga
gattttggatgttcagtaaagctcaaaaacaatgcccagaccatgcctggtgaagtgaac
agcaccctggggacagcagcatacatggcacctgaagtcatcactcgtgccaaaggagag
ggccatgggcgtgcggccgacatctggagtctggggtgtgttgtcatagagatggtgact
ggcaagaggccttggcatgagtatgagcacaactttcaaattatgtataaagtggggatg
ggacataagccaccaatccctgaaagattaagccctgaaggaaaggacttcctttctcac
tgccttgagagtgacccaaagatgagatggaccgccagccagctcctcgaccattcgttt
gtcaaggtttgcacagatgaagaatga

DBGET integrated database retrieval system