KEGG   Homo sapiens (human): 4225Help
Entry
4225              CDS       T01001                                 

Gene name
MEP1B
Definition
meprin A, beta (EC:3.4.24.63)
Orthology
K08606  
meprin A, beta [EC:3.4.24.18]
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    4225 (MEP1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.18  meprin A
     4225 (MEP1B)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   4225 (MEP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q12.2-q12.3
AA seq 701 aa AA seqDB search
MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
EYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLI
SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVG
TVALFSNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTP
APSVQDLCSKTTCKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSST
VAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHAF
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggatttatggaatctgtcttggtttctgttcttggatgctcttctcgtgatttctggc
ttggcaactccagaaaactttgatgtagatggcggaatggaccaggacatatttgatatc
aatgaaggtttgggactggatctttttgagggtgacatcagacttgatagggcacaaatt
agaaattccatcattggagaaaagtatagatggcctcataccattccatatgttctagaa
gatagcttggaaatgaatgctaagggagttatcctcaatgcatttgaacgttatcgcctt
aaaacatgtattgactttaagccttgggctggagaaacaaactatatatcagtgttcaag
ggcagtggctgctggtcttcagtaggaaataggcgggttgggaagcaagaactttccatc
ggggcaaactgtgaccgaatagcaacagttcaacacgagttcctccacgctctgggattc
tggcatgagcagtcgcgttctgaccgggatgactatgtcaggataatgtgggacagaatt
ctgtcaggcagagagcacaattttaacacctatagtgacgatatatcagattccctgaat
gttccctatgattacacttcagtaatgcactacagtaaaactgcattccaaaatggaaca
gagccgacaattgtcacaagaatctcagactttgaggatgtgatcggccaacgaatggat
ttcagtgactctgatctcctaaagttgaatcaactgtataactgctcctcttccttgagt
tttatggactcgtgcagttttgaactggaaaatgtgtgtggcatgatccaaagttcagga
gataatgctgactggcaacgggtttcacaggttcccagggggccagagagtgatcactcc
aacatgggccagtgccaaggttctggtttcttcatgcatttcgatagcagctctgtaaat
gtgggggccacagcagtgctggaaagtagaacgctgtaccctaaaagaggatttcagtgc
ctgcaattttacttatataacagtggcagtgaaagtgatcaactgaacatctatatcagg
gagtattctgcagacaatgtggatggcaatttaacccttgtggaagaaataaaagaaata
cccactgggagctggcaactttatcatgtaacattgaaagtgaccaagaagtttagagtg
gtgtttgaaggacgcaaaggctctggtgcatcactgggtggtctgtctattgatgacatc
aatctttcggaaacacggtgccctcatcatatctggcatataaggaatttcacacagttc
attggcagcccaaatggaactctgtatagccctccattttactcttctaaaggttatgcc
tttcagatttacttaaatctagcccatgtgactaatgcagggatatatttccacttgatc
tctggagccaatgatgatcaattacagtggccatgtccttggcaacaagccacaatgaca
cttttggatcaaaatcctgacattcgacagcgtatgtccaatcagcggagtataactaca
gacccatttatgaccaccgataatggaaactatttctgggacaggccttctaaagtggga
acagtggctttgttctctaatggaactcagtttagaagaggtgggggctatggaaccagt
gcctttataacccacgaaaggctgaaaagcagagattttataaaaggagatgatgtttat
atcctactgacagtggaagacatatctcacctcaactctacacaaatccagctaacacca
gcccctagtgttcaagacctctgctcaaaaaccacctgtaaaaatgacggtgtctgcact
gttcgagatggcaaagctgagtgcaggtgccagtcaggggaagactggtggtacatggga
gaaaggtgtgaaaagagaggctccacccgagacaccatagtcattgctgtttcatctact
gttgctgtgtttgccttgatgctgatcatcacccttgtcagtgtctattgcaccaggaag
aaatatcgtgaaaggatgagctcaaatcgaccaaatttgactccgcaaaatcagcatgct
ttttga

DBGET integrated database retrieval system