KEGG   Homo sapiens (human): 4233Help
Entry
4233              CDS       T01001                                 

Gene name
MET, AUTS9, HGFR, RCCP2, c-Met
Definition
MET proto-oncogene, receptor tyrosine kinase (EC:2.7.10.1)
Orthology
K05099  
proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
Adherens junction
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Malaria
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Melanoma
Disease
H00018  
Gastric cancer
H00021  
Renal cell carcinoma
H00046  
Cholangiocarcinoma
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4233 (MET)
   04015 Rap1 signaling pathway
    4233 (MET)
   04151 PI3K-Akt signaling pathway
    4233 (MET)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4233 (MET)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4233 (MET)
  Cellular commiunity
   04510 Focal adhesion
    4233 (MET)
   04520 Adherens junction
    4233 (MET)
 Organismal Systems
  Development
   04360 Axon guidance
    4233 (MET)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4233 (MET)
   05202 Transcriptional misregulation in cancers
    4233 (MET)
   05206 MicroRNAs in cancer
    4233 (MET)
   05205 Proteoglycans in cancer
    4233 (MET)
   05218 Melanoma
    4233 (MET)
   05211 Renal cell carcinoma
    4233 (MET)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4233 (MET)
   05100 Bacterial invasion of epithelial cells
    4233 (MET)
   05144 Malaria
    4233 (MET)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4233 (MET)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Met family
   4233 (MET)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VI (HGF receptor family)
   4233 (MET)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VI (HGF receptor family)
   4233 (MET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31
AA seq 1390 aa AA seqDB search
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacacccatccagaatgtcattctacatgagcat
cacattttccttggtgccactaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagactgggcctgtgctggaacacccagattgtttcccatgtcaggac
tgcagcagcaaagccaatttatcaggaggtgtttggaaagataacatcaacatggctcta
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccagccagtgtcctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaatacc
ataaattcttcttatttcccagatcatccattgcattcgatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtatgtccatgcctttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccataaactctggattgcattcctacatggaaatgcctctggagtgtattctc
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatacttcaggctgcg
tatgtcagcaagcctggggcccagcttgctagacaaataggagccagcctgaatgatgac
attcttttcggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gccatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttacggacccaatcatgagcactgctttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgaacagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcattaaaggagacctcaccatagctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactcccatccagtgtctccagaagtgattgtggagcatacattaaaccaaaatggc
tacacactggttatcactgggaagaagatcacgaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcaatgcctctctgccccaccctttgttcagtgtggctgg
tgccacgacaaatgtgtgcgatcggaggaatgcctgagcgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaaatagtgcaccccttgaaggagggacaagg
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccataattatt
tcaaatggccacgggacaacacaatacagtacattctcctatgtggatcctgtaataaca
agtatttcgccgaaatacggtcctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgtgaa
gatcccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgaattcagttagtgtcccgagaatggtcataaatgtgcat
gaagcaggaaggaactttacagtggcatgtcaacatcgctctaattcagagataatctgt
tgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctca
atatcaacagcactgttattactacttgggtttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctacgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaa
gtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gccccaccttatcctgacgtaaacacctttgatataactgtttacttgttgcaagggaga
agactcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaacgtaaaa
tgtgtcgctccgtatccttctctgttgtcatcagaagataacgctgatgatgaggtggac
acacgaccagcctccttctgggagacatcatag

DBGET integrated database retrieval system