KEGG   Homo sapiens (human): 4233Help
Entry
4233              CDS       T01001                                 

Gene name
MET, AUTS9, HGFR, RCCP2, c-Met
Definition
met proto-oncogene (EC:2.7.10.1)
Orthology
K05099  
proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
Adherens junction
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Malaria
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Melanoma
Disease
H00018  
Gastric cancer
H00021  
Renal cell carcinoma
H00046  
Cholangiocarcinoma
Drug target
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31
AA seq 1390 aa AA seqDB search
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacacccatccagaatgtcattctacatgagcat
cacattttccttggtgccactaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagactgggcctgtgctggaacacccagattgtttcccatgtcaggac
tgcagcagcaaagccaatttatcaggaggtgtttggaaagataacatcaacatggctcta
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccagccagtgtcctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaatacc
ataaattcttcttatttcccagatcatccattgcattcgatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtatgtccatgcctttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccataaactctggattgcattcctacatggaaatgcctctggagtgtattctc
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatacttcaggctgcg
tatgtcagcaagcctggggcccagcttgctagacaaataggagccagcctgaatgatgac
attcttttcggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gccatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttacggacccaatcatgagcactgctttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgaacagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcattaaaggagacctcaccatagctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactcccatccagtgtctccagaagtgattgtggagcatacattaaaccaaaatggc
tacacactggttatcactgggaagaagatcacgaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcaatgcctctctgccccaccctttgttcagtgtggctgg
tgccacgacaaatgtgtgcgatcggaggaatgcctgagcgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaaatagtgcaccccttgaaggagggacaagg
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccataattatt
tcaaatggccacgggacaacacaatacagtacattctcctatgtggatcctgtaataaca
agtatttcgccgaaatacggtcctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgtgaa
gatcccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgaattcagttagtgtcccgagaatggtcataaatgtgcat
gaagcaggaaggaactttacagtggcatgtcaacatcgctctaattcagagataatctgt
tgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctca
atatcaacagcactgttattactacttgggtttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctacgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaa
gtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gccccaccttatcctgacgtaaacacctttgatataactgtttacttgttgcaagggaga
agactcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaacgtaaaa
tgtgtcgctccgtatccttctctgttgtcatcagaagataacgctgatgatgaggtggac
acacgaccagcctccttctgggagacatcatag

DBGET integrated database retrieval system