KEGG   Homo sapiens (human): 4242Help
Entry
4242              CDS       T01001                                 

Gene name
MFNG
Definition
MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (EC:2.4.1.222)
Orthology
K05948  
fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    4242 (MFNG)
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    4242 (MFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     4242 (MFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   4242 (MFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12
AA seq 307 aa AA seqDB search
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAV
KTTRAFHRLRLELLLDTWVSRTREQVTRSHLVVTNCSAEHSHPALSCKMAAEFDTFLASG
LRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWF
ATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFH
SHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPW
CPQLGAR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgccggctcccgcggggcctggctggagccctcctcaccctcctgtgcatgggg
ctcctgtgtctgcggtaccacttgaacctgtccccgcagcgggtacaagggacccccgag
ctgagccagccgaacccggggccccctaagctacagctacacgatgtcttcattgcagtg
aagacgacccgggctttccaccgcttgcgcctggagctgctgcttgacacgtgggtttcc
aggaccagggaacaggtgacaaggtcccaccttgtggtcaccaactgctccgcggaacac
agccacccagctctgtcctgcaagatggctgctgagttcgacaccttcttggccagtggg
cttaggtggttctgccatgtggacgatgacaactatgtgaacccaagggcgctgctgcag
cttctgagagccttcccgctggcccgcgacgtctatgtgggaaggcccagcctgaaccgg
cccatccatgcctcagagccacagccccacaaccgcacgaggctggtacagttctggttt
gccactgggggtgctggcttctgcatcaatcgcaaactggctttgaagatggctccgtgg
gccagtggctcccgtttcatggacacatctgctctcatccggctgcctgatgactgcacc
atgggctatatcattgagtgcaagctgggcggccgcctgcagcccagccccctctttcac
tcccacctggagaccctgcagctgctgaggactgcacagctcccagaacaggtcaccctc
agctacggtgtctttgaggggaaactcaacgtcattaagctacagggccccttctccccg
gaggaggacccctccagatttcgctccctccattgtctgctctatccagatacaccctgg
tgtccccagctgggtgcccgatga

DBGET integrated database retrieval system