KEGG   Homo sapiens (human): 4254Help
Entry
4254              CDS       T01001                                 

Gene name
KITLG, FPH2, KL-1, Kitl, MGF, SCF, SF, SHEP7
Definition
KIT ligand
Orthology
K05461  
KIT ligand
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Melanogenesis
Pathways in cancer
Disease
H00884  
Familial progressive hyperpigmentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4254 (KITLG)
   04015 Rap1 signaling pathway
    4254 (KITLG)
   04151 PI3K-Akt signaling pathway
    4254 (KITLG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4254 (KITLG)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    4254 (KITLG)
  Endocrine system
   04916 Melanogenesis
    4254 (KITLG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4254 (KITLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q22
AA seq 273 aa AA seqDB search
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatcttcagctgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattggtggcaaatcttccaaaagactacatgataaccctcaaatatgtccccggg
atggatgttttgccaagtcattgttggataagcgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctctttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggactttgtagtggcatctgaaact
agtgattgtgtggtttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggccaaaaatccccctggagactccagcctacactgggcagccatggcattg
ccagcattgttttctcttataattggctttgcttttggagccttatactggaagaagaga
cagccaagtcttacaagggcagttgaaaatatacaaattaatgaagaggataatgagata
agtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system