KEGG   Homo sapiens (human): 4257Help
Entry
4257              CDS       T01001                                 

Gene name
MGST1, GST12, MGST, MGST-I
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    4257 (MGST1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4257 (MGST1)
   00982 Drug metabolism - cytochrome P450
    4257 (MGST1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    4257 (MGST1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4257 (MGST1)
  Drug resistance
   01524 Platinum drug resistance
    4257 (MGST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4257 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P10620(Tbio)
UniProt: 
Position
12p12.3
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcatcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttgagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

DBGET integrated database retrieval system