KEGG   Homo sapiens (human): 4257Help
Entry
4257              CDS       T01001                                 

Gene name
MGST1, GST12, MGST, MGST-I
Definition
microsomal glutathione S-transferase 1 (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12.3-p12.1
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcatcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttgagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

DBGET integrated database retrieval system