KEGG   Homo sapiens (human): 4258Help
Entry
4258              CDS       T01001                                 

Gene name
MGST2, GST2, MGST-II
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Network
N00243  
KEAP1-NRF2 signaling pathway
N00244  
Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  
Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    4258 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4258 (MGST2)
   00982 Drug metabolism - cytochrome P450
    4258 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4258 (MGST2)
   05204 Chemical carcinogenesis
    4258 (MGST2)
   05225 Hepatocellular carcinoma
    4258 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4258 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    4258 (MGST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4258 (MGST2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   4258 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q99735(Tbio)
UniProt: 
Position
4q31.1
AA seq 147 aa AA seqDB search
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaactcgatcctgctggctgctgtctctattctctcggcctgtcagcaaagt
tattttgctttgcaagttggaaaggcaagattaaaatacaaagttacgcccccagcagtc
actgggtcaccagagtttgagagagtatttcgggcacaacaaaactgtgtggagttttat
cctatattcataattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatatatggccgtcacctatacttctggggatattcagaagct
gctaaaaaacggatcaccggtttccgactgagtctggggattttggccttgttgaccctc
ctaggtgccctgggaattgcaaacagctttctggatgaatatctggacctcaatattgcc
aagaaactgaggcggcaattctaa

DBGET integrated database retrieval system