KEGG   Homo sapiens (human): 427Help
Entry
427               CDS       T01001                                 

Gene name
ASAH1, AC, ACDase, ASAH, PHP, PHP32, SMAPME
Definition
N-acylsphingosine amidohydrolase (acid ceramidase) 1 (EC:3.5.1.23)
Orthology
K12348  
acid ceramidase [EC:3.5.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Module
Sphingosine biosynthesis
Disease
H00138  
Farber lipogranulomatosis
H00424  
Defects in the degradation of sphingomyelin
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p22
AA seq 389 aa AA seqDB search
MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVF
PAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIP
LGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLT
VNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDV
MWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYE
LDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNK
LTVYTTLIDVTKGQFETYLRDCPDPCIGW
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaactgctgcatcgggctgggagagaaagctcgcgggtcccaccgggcctcctaccca
agtctcagcgcgcttttcaccgaggcctcaattctgggatttggcagctttgctgtgaaa
gcccaatggacagaggactgcagaaaatcaacctatcctccttcaggaccaactgtcttc
cctgctgttataaggtacagaggtgcagttccatggtacaccataaatcttgacttacca
ccctacaaaagatggcatgaattgatgcttgacaaggcaccagtgcctggcctacttggc
aactttcctggcccttttgaagaggaaatgaagggtattgccgctgttactgatatacct
ttaggagagattatttcattcaatattttttatgaattatttaccatttgtacttcaata
gtagcagaagacaaaaaaggtcatctaatacatgggagaaacatggattttggagtattt
cttgggtggaacataaataatgatacctgggtcataactgagcaactaaaacctttaaca
gtgaatttggatttccaaagaaacaacaaaactgtcttcaaggcttcaagctttgctggc
tatgtgggcatgttaacaggattcaaaccaggactgttcagtcttacactgaatgaacgt
ttcagtataaatggtggttatctgggtattctagaatggattctgggaaagaaagatgtc
atgtggatagggttcctcactagaacagttctggaaaatagcacaagttatgaagaagcc
aagaatttattgaccaagaccaagatattggccccagcctactttatcctgggaggcaac
cagtctggggaaggttgtgtgattacacgagacagaaaggaatcattggatgtatatgaa
ctcgatgctaagcagggtagatggtatgtggtacaaacaaattatgaccgttggaaacat
cccttcttccttgatgatcgcagaacgcctgcaaagatgtgtctgaaccgcaccagccaa
gagaatatctcatttgaaaccatgtatgatgtcctgtcaacaaaacctgtcctcaacaag
ctgaccgtatacacaaccttgatagatgttaccaaaggtcaattcgaaacttacctgcgg
gactgccctgacccttgtataggttggtga

DBGET integrated database retrieval system