KEGG   Homo sapiens (human): 427Help
Entry
427               CDS       T01001                                 

Gene name
ASAH1, AC, ACDase, ASAH, PHP, PHP32, SMAPME
Definition
(RefSeq) N-acylsphingosine amidohydrolase 1
  KO
K12348  
acid ceramidase [EC:3.5.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
Lysosome
Module
Sphingosine biosynthesis
Disease
H00138  
Farber lipogranulomatosis
H00424  
Defects in the degradation of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    427 (ASAH1)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    427 (ASAH1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    427 (ASAH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     427 (ASAH1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C89
   427 (ASAH1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   427 (ASAH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p22
AA seq 395 aa AA seqDB search
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYK
RWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
QLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWI
LGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLST
KPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccgggccggagttgcgtcgccttagtcctcctggctgccgccgtcagctgtgccgtc
gcgcagcacgcgccgccgtggacagaggactgcagaaaatcaacctatcctccttcagga
ccaacgtacagaggtgcagttccatggtacaccataaatcttgacttaccaccctacaaa
agatggcatgaattgatgcttgacaaggcaccagtgctaaaggttatagtgaattctctg
aagaatatgataaatacattcgtgccaagtggaaaaattatgcaggtggtggatgaaaaa
ttgcctggcctacttggcaactttcctggcccttttgaagaggaaatgaagggtattgcc
gctgttactgatatacctttaggagagattatttcattcaatattttttatgaattattt
accatttgtacttcaatagtagcagaagacaaaaaaggtcatctaatacatgggagaaac
atggattttggagtatttcttgggtggaacataaataatgatacctgggtcataactgag
caactaaaacctttaacagtgaatttggatttccaaagaaacaacaaaactgtcttcaag
gcttcaagctttgctggctatgtgggcatgttaacaggattcaaaccaggactgttcagt
cttacactgaatgaacgtttcagtataaatggtggttatctgggtattctagaatggatt
ctgggaaagaaagatgtcatgtggatagggttcctcactagaacagttctggaaaatagc
acaagttatgaagaagccaagaatttattgaccaagaccaagatattggccccagcctac
tttatcctgggaggcaaccagtctggggaaggttgtgtgattacacgagacagaaaggaa
tcattggatgtatatgaactcgatgctaagcagggtagatggtatgtggtacaaacaaat
tatgaccgttggaaacatcccttcttccttgatgatcgcagaacgcctgcaaagatgtgt
ctgaaccgcaccagccaagagaatatctcatttgaaaccatgtatgatgtcctgtcaaca
aaacctgtcctcaacaagctgaccgtatacacaaccttgatagatgttaccaaaggtcaa
ttcgaaacttacctgcgggactgccctgacccttgtataggttggtga

DBGET integrated database retrieval system