KEGG   Homo sapiens (human): 427Help
Entry
427               CDS       T01001                                 

Gene name
ASAH1, AC, ACDase, ASAH, PHP, PHP32, SMAPME
Definition
N-acylsphingosine amidohydrolase (acid ceramidase) 1 (EC:3.5.1.23)
Orthology
K12348  
acid ceramidase [EC:3.5.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Module
Sphingosine biosynthesis
Disease
H00138  
Farber lipogranulomatosis
H00424  
Defects in the degradation of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    427 (ASAH1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    427 (ASAH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     427 (ASAH1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C89
   427 (ASAH1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   427 (ASAH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p22
AA seq 389 aa AA seqDB search
MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVF
PAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIP
LGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLT
VNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDV
MWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYE
LDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNK
LTVYTTLIDVTKGQFETYLRDCPDPCIGW
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaactgctgcatcgggctgggagagaaagctcgcgggtcccaccgggcctcctaccca
agtctcagcgcgcttttcaccgaggcctcaattctgggatttggcagctttgctgtgaaa
gcccaatggacagaggactgcagaaaatcaacctatcctccttcaggaccaactgtcttc
cctgctgttataaggtacagaggtgcagttccatggtacaccataaatcttgacttacca
ccctacaaaagatggcatgaattgatgcttgacaaggcaccagtgcctggcctacttggc
aactttcctggcccttttgaagaggaaatgaagggtattgccgctgttactgatatacct
ttaggagagattatttcattcaatattttttatgaattatttaccatttgtacttcaata
gtagcagaagacaaaaaaggtcatctaatacatgggagaaacatggattttggagtattt
cttgggtggaacataaataatgatacctgggtcataactgagcaactaaaacctttaaca
gtgaatttggatttccaaagaaacaacaaaactgtcttcaaggcttcaagctttgctggc
tatgtgggcatgttaacaggattcaaaccaggactgttcagtcttacactgaatgaacgt
ttcagtataaatggtggttatctgggtattctagaatggattctgggaaagaaagatgtc
atgtggatagggttcctcactagaacagttctggaaaatagcacaagttatgaagaagcc
aagaatttattgaccaagaccaagatattggccccagcctactttatcctgggaggcaac
cagtctggggaaggttgtgtgattacacgagacagaaaggaatcattggatgtatatgaa
ctcgatgctaagcagggtagatggtatgtggtacaaacaaattatgaccgttggaaacat
cccttcttccttgatgatcgcagaacgcctgcaaagatgtgtctgaaccgcaccagccaa
gagaatatctcatttgaaaccatgtatgatgtcctgtcaacaaaacctgtcctcaacaag
ctgaccgtatacacaaccttgatagatgttaccaaaggtcaattcgaaacttacctgcgg
gactgccctgacccttgtataggttggtga

DBGET integrated database retrieval system