KEGG   Homo sapiens (human): 4277Help
Entry
4277              CDS       T01001                                 

Gene name
MICB, PERB11.2
Definition
(RefSeq) MHC class I polypeptide-related sequence B
  KO
K07985  
MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    4277 (MICB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 383 aa AA seqDB search
MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
DAAQLGFQPLMSATGSTGSTEGT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggccgggtcctgctgtttctggccgtcgccttcccttttgcacccccggca
gccgccgctgagccccacagtcttcgttacaacctcatggtgctgtcccaggatggatct
gtgcagtcagggtttctcgctgagggacatctggatggtcagcccttcctgcgctatgac
aggcagaaacgcagggcaaagccccagggacagtgggcagaaaatgtcctgggagctaag
acctgggacacagagaccgaggacttgacagagaatgggcaagacctcaggaggaccctg
actcatatcaaggaccagaaaggaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacagcagcaccaggggctcccggcatttctactacgatggggagctcttc
ctctcccaaaacctggagactcaagaatcgacagtgccccagtcctccagagctcagacc
ttggctatgaacgtcacaaatttctggaaggaagatgccatgaagaccaagacacactat
cgcgctatgcaggcagactgcctgcagaaactacagcgatatctgaaatccggggtggcc
atcaggagaacagtgccccccatggtgaatgtcacctgcagcgaggtctcagagggcaac
atcaccgtgacatgcagggcttccagcttctatccccggaatatcacactgacctggcgt
caggatggggtatctttgagccacaacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggattcgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacggcactcaccctgtgccctctgggaaggcg
ctggtgcttcagagtcaacggacagactttccatatgtttctgctgctatgccatgtttt
gttattattattattctctgtgtcccttgttgcaagaagaaaacatcagcggcagagggt
ccagagcttgtgagcctgcaggtcctggatcaacacccagttgggacaggagaccacagg
gatgcagcacagctgggatttcagcctctgatgtcagctactgggtccactggttccact
gagggcacctag

DBGET integrated database retrieval system