KEGG   Homo sapiens (human): 4282Help
Entry
4282              CDS       T01001                                 

Gene name
MIF, GIF, GLIF, MMIF
Definition
macrophage migration inhibitory factor (glycosylation-inhibiting factor) (EC:5.3.3.12 5.3.2.1)
Orthology
K07253  
phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Phenylalanine metabolism
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hsa00360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 115 aa AA seqDB search
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgttcatcgtaaacaccaacgtgccccgcgcctccgtgccggacgggttcctc
tccgagctcacccagcagctggcgcaggccaccggcaagcccccccagtacatcgcggtg
cacgtggtcccggaccagctcatggccttcggcggctccagcgagccgtgcgcgctctgc
agcctgcacagcatcggcaagatcggcggcgcgcagaaccgctcctacagcaagctgctg
tgcggcctgctggccgagcgcctgcgcatcagcccggacagggtctacatcaactattac
gacatgaacgcggccaatgtgggctggaacaactccaccttcgcctaa

DBGET integrated database retrieval system