KEGG   Homo sapiens (human): 4293Help
Entry
4293              CDS       T01001                                 

Gene name
MAP3K9, MEKK9, MLK1, PRKE1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9 (EC:2.7.11.25)
  KO
K04417  
mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4293 (MAP3K9)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   4293 (MAP3K9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.2
AA seq 1104 aa AA seqDB search
MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAAVGPGELGCDAPLPYWTAV
FEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSR
CQPGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDED
ISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPD
ILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLARE
WHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYG
VAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFH
CLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDIL
ERELNIIIHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRK
SLINSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWG
PGTLGQKELASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGP
RSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEE
PTPVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLLEAGKCQLLPL
EEPEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSI
SECNSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSLTPTH
VTLTTPSQPSSHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPR
LPDPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSP
ANSSSTETPSNLDSCFASSSSTVEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDST
VPLCRAELNTHRPAPYEIQQEFWS
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atggagccctccagagcgcttctcggctgcctagcgagcgccgccgctgccgccccgccg
ggggaggatggagcaggggccggggccgaggaggaggaggaggaggaggaggaggcggcg
gcggcggtgggccccggggagctgggctgcgacgcgccgctgccctactggacggccgtg
ttcgagtacgaggcggcgggcgaggacgagctgaccctgcggctgggcgacgtggtggag
gtgctgtccaaggactcgcaggtgtccggcgacgagggctggtggaccgggcagctgaac
cagcgggtgggcatcttccccagcaactacgtgaccccgcgcagcgccttctccagccgc
tgccagcccggcggcgaggaccccagttgctacccgcccattcagttgttagaaattgat
tttgcggagctcaccttggaagagattattggcatcgggggctttgggaaggtctatcgt
gctttctggataggggatgaggttgctgtgaaagcagctcgccacgaccctgatgaggac
atcagccagaccatagagaatgttcgccaagaggccaagctcttcgccatgctgaagcac
cccaacatcattgccctaagaggggtatgtctgaaggagcccaacctctgcttggtcatg
gagtttgctcgtggaggacctttgaatagagtgttatctgggaaaaggattcccccagac
atcctggtgaattgggctgtgcagattgccagagggatgaactacttacatgatgaggca
attgttcccatcatccaccgcgaccttaagtccagcaacatattgatcctccagaaggtg
gagaatggagacctgagcaacaagattctgaagatcactgattttggcctggctcgggaa
tggcaccgaaccaccaagatgagtgcggcagggacgtatgcttggatggcacccgaagtc
atccgggcctccatgttttccaaaggcagtgatgtgtggagctatggggtgctactttgg
gagttgctgactggtgaggtgccctttcgaggcattgatggcttagcagtcgcttatgga
gtggccatgaacaaactcgcccttcctattccttctacgtgcccagaaccttttgccaaa
ctcatggaagactgctggaatcctgatccccactcacgaccatctttcacgaatatcctg
gaccagctaaccaccatagaggagtctggtttctttgaaatgcccaaggactccttccac
tgcctgcaggacaactggaaacacgagattcaggagatgtttgaccaactcagggccaaa
gaaaaggaacttcgcacctgggaggaggagctgacgcgggctgcactgcagcagaagaac
caggaggaactgctgcggcgtcgggagcaggagctggccgagcgggagattgacatcctg
gaacgggagctcaacatcatcatccaccagctgtgccaggagaagccccgggtgaagaaa
cgcaagggcaagttcaggaagagccggctgaagctcaaggatggcaaccgcatcagcctc
ccttctgatttccagcacaagttcacggtgcaggcctcccctaccatggataaaaggaag
agtcttatcaacagccgctccagtcctcctgcaagccccaccatcattcctcgccttcga
gccatccagttgacaccaggtgaaagcagcaaaacctggggcaggagctcagtcgtccca
aaggaggaaggggaggaggaggagaagagggccccaaagaagaagggacggacgtggggg
ccagggacgcttggtcagaaggagcttgcctcgggagatgaaggatcccctcagagacgt
gagaaagctaatggtttaagtaccccatcagaatctccacatttccacttgggcctcaag
tccctggtagatggatataagcagtggtcgtccagtgcccccaacctggtgaagggccca
aggagtagcccggccctgccagggttcaccagccttatggagatggaggatgaggacagt
gaaggcccagggagtggagagagtcgcctacagcattcacccagccagtcctacctctgt
atcccattccctcgtggagaggatggcgatggcccctccagtgatggaatccatgaggag
cccaccccagtcaactcggccacgagtacccctcagctgacgccaaccaacagcctcaag
cggggcggtgcccaccaccgccgctgcgaggtggctctgctcggctgtggggctgttctg
gcagccacaggcctagggtttgacttgctggaagctggcaagtgccagctgcttcccctg
gaggagcctgagccaccagcccgggaggagaagaaaagacgggagggtctttttcagagg
tccagccgtcctcgtcggagcaccagccccccatcccgaaagcttttcaagaaggaggag
cccatgctgttgctaggagacccctctgcctccctgacgctgctctccctctcctccatc
tccgagtgcaactccacacgctccctgctgcgctccgacagcgatgaaattgtcgtgtat
gagatgccagtcagcccagtcgaggcccctcccctgagtccatgtacccacaaccccctg
gtcaatgtccgagtagagcgcttcaaacgagatcctaaccaatctctgactcccacccat
gtcaccctcaccaccccctcgcagcccagcagtcaccggcggactccttctgatggggcc
cttaagccagagactctcctagccagcaggagcccctccagcaatgggttgagccccagt
cctggagcaggaatgttgaaaacccccagtcccagccgagacccaggtgaattcccccgt
ctccctgaccccaatgtggtcttccccccaaccccaaggcgctggaacactcagcaggac
tctaccttggagagacccaagactctggagtttctgcctcggccgcgtccttctgccaac
cggcaacggctggacccttggtggtttgtgtcccccagccatgcccgcagcacctcccca
gccaacagctccagcacagagacgcccagcaacctggactcctgctttgctagcagtagc
agcactgtagaggagcggcctggacttccagccctgctcccgttccaggcagggccgctg
cccccgactgagcggacgctcctggacctggatgcagaggggcagagtcaggacagcacc
gtgccgctgtgcagagcggaactgaacacacacaggcctgccccttatgagatccagcag
gagttctggtcttag

DBGET integrated database retrieval system