KEGG   Homo sapiens (human): 4294Help
Entry
4294              CDS       T01001                                 

Gene name
MAP3K10, MEKK10, MLK2, MST
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 10 (EC:2.7.11.25)
  KO
K04418  
mitogen-activated protein kinase kinase kinase 10 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4294 (MAP3K10)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   4294 (MAP3K10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 954 aa AA seqDB search
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSR
GGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPP
ARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRG
LSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP
PAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP
EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggagggggcggtggccaaggagtggggcacgacccccgcggggcccgtc
tggaccgcggtgttcgactacgaggcggcgggcgacgaggagctgaccctgcggaggggc
gatcgcgtccaggtgctttcccaagactgtgcggtgtccggcgacgagggctggtggacc
gggcagctccccagcggccgcgtgggcgtcttccccagcaactacgtggcccccggcgcc
cccgctgcacccgcgggcctccagctgccccaggagatccccttccacgagctgcagcta
gaggagatcatcggtgtggggggctttggcaaggtctatcgggccctgtggcgtggcgag
gaggtggcagtcaaggccgcccggctggaccctgagaaggacccggcagtgacagcggag
caggtgtgccaggaagcccggctctttggagccctgcagcaccccaacataattgccctt
aggggcgcctgcctcaaccccccacacctctgcctagtgatggagtatgcccggggtggt
gcactgagcagggtgctggcaggtcgccgggtgccacctcacgtgctggtcaactgggct
gtgcaggtggcccggggcatgaactacctacacaatgatgcccctgtgcccatcatccac
cgggacctcaagtccatcaacatcctgatcctggaggccatcgagaaccacaacctcgca
gacacggtgctcaagatcacggacttcggcctcgcccgcgagtggcacaagaccaccaag
atgagcgctgcggggacctacgcctggatggcgccggaggttatccgtctctccctcttc
tccaaaagcagtgatgtctggagcttcggggtgctgctgtgggagctgctgacgggggag
gtcccctaccgtgagatcgacgccttggccgtggcgtatggcgtggctatgaataagctg
acgctgcccattccctccacgtgccccgagccctttgcccgcctcctggaggaatgctgg
gacccagacccccacgggcggccagatttcggtagcatcttgaagcggcttgaagtcatc
gaacagtcagccctgttccagatgccactggagtccttccactcgctgcaggaagactgg
aagctggagattcagcacatgtttgatgaccttcggaccaaggagaaggagcttcggagc
cgtgaggaggagctgctgcgggcggcacaggagcagcgcttccaggaggagcagctgcgg
cggcgggagcaggagctggcagaacgtgagatggacatcgtggaacgggagctgcacctg
ctcatgtgccagctgagccaggagaagccccgggtccgcaagcgcaagggcaacttcaag
cgcagccgcctgctcaagctgcgggaaggcggcagccacatcagcctgccctctggcttt
gagcataagatcacagtccaggcctctccaactctggataagcggaaaggatccgatggg
gccagcccccctgcaagccccagcatcatcccccggctgagggccattcgcctgactccc
gtggactgtggtggcagcagcagtggcagcagcagtggaggaagtgggacatggagccgc
ggtgggcccccaaagaaggaagaactggtcgggggcaagaagaagggacgaacgtggggg
cccagctccaccctgcagaaggagcgggtgggaggagaggagaggctgaaggggctgggg
gaaggaagcaaacagtggtcatcaagtgcccccaacctgggcaagtcccccaaacacaca
cccatcgcccctggctttgccagcctcaatgagatggaggagttcgcggaggcagaggat
ggaggcagcagcgtgcccccttccccctactcgaccccgtcctacctctcagtgccactg
cctgccgagccctccccgggggcgcgggcgccgtgggagccgacgccgtccgcgcccccc
gctcggtggggacacggcgcccggcggcgctgcgacctggcgctgctaggctgcgccacg
ctgctgggggctgtgggcctgggcgccgacgtggccgaggcgcgcgcggccgacggtgag
gagcagcggcgctggctcgacggcctcttctttccccgcgccggccgcttcccgcggggc
ctcagcccacccgcgcgtccccacggccgccgcgaagacgtgggccccggcctgggcctg
gcgccctcggccaccctcgtgtcgctgtcgtccgtgtccgactgcaactccacgcgttca
ctgctgcgctctgacagtgacgaggccgcaccggccgcgccctccccaccaccctccccg
cccgcgcccacacccacgccctcgcccagcaccaaccccctggtggacctggagctggag
agcttcaagaaggacccccgccagtcgctcacgcccacccacgtcacggctgcatgcgct
gtgagccgcgggcaccggcggacgccatcggacggggcgctggggcagcgggggccgccc
gagcccgcgggccatggccctggccctcgtgaccttctggacttcccccgcctgcccgac
ccccaggccctgttcccagcccgccgccggccccctgagttcccaggccgccccaccacc
ctgacctttgccccgagacctcggccggctgccagtcgcccccgcttggacccctggaaa
ctggtctccttcggccggacactcaccatctcgcctcccagcaggccagacactccggag
agccctgggccccccagcgtgcagcccacactgctggacatggacatggaggggcagaac
caagacagcacagtgcccctgtgcggggcccacggctcccactaa

DBGET integrated database retrieval system