KEGG   Homo sapiens (human): 4295Help
Entry
4295              CDS       T01001                                 

Gene name
MLN
Definition
motilin
Orthology
K05265  
motilin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4295 (MLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 114 aa AA seqDB search
MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEE
GPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtatcccgtaaggctgtggctgctctgctggtggtgcatgtagctgccatgctggcc
tcccagacggaagccttcgtccccatcttcacctatggcgaactccagaggatgcaggaa
aaggaacggaataaagggcaaaagaaatccctgagtgtatggcagaggtctggggaggaa
ggtcctgtagaccctgcggagcccatcagggaagaagaaaacgaaatgatcaagctgact
gctcctctggaaattggaatgaggatgaactccagacagctggaaaagtacccggccacc
ctggaagggctgctgagtgagatgcttccccagcatgccaagtga

DBGET integrated database retrieval system