KEGG   Homo sapiens (human): 4297Help
Entry
4297              CDS       T01001                                 

Gene name
KMT2A, ALL-1, CXXC7, HRX, HTRX1, MLL, MLL/GAS7, MLL1, MLL1A, TET1-MLL, TRX1, WDSTS
Definition
lysine (K)-specific methyltransferase 2A (EC:2.1.1.43)
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
H00002  
Acute lymphoblastic leukemia (ALL) (precursor T lymphoblastic leukemia)
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 3972 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKD
ISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSS
SPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPED
VGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSL
SISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKI
LIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTD
KRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKA
PQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVP
KTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNIL
STLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNK
CRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCA
KLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESV
AYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETE
ESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAA
INSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPS
LDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSRED
SPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGS
LKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRH
RDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDL
SDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAH
SPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSP
GCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGN
TYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKN
SHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHN
TTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDT
EVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEE
GNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRK
RTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNN
TSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGV
RSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERL
ASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDR
PEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSD
KNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNL
GEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTR
SPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQG
HMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPS
QISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMET
NTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNI
SNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPS
STPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFE
PAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSAS
VPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPST
AAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASG
PQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPK
PKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVE
QSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRK
ESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGL
RMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDM
FNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSP
IHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATM
HGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPC
NCGAKKCRKFLN
NT seq 11919 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcgccggggcctagggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgtg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagaggatgagcaattcttaggttttggctcagatgaagaagtcagagtgcga
agtcccacaaggtctccttcagttaaaactagtcctcgaaaacctcgtgggagacctaga
agtggctctgaccgaaattcagctatcctctcagatccatctgtgttttcccctctaaat
aaatcagagaccaaatctggagataagatcaagaagaaagattctaaaagtatagaaaag
aagagaggaagacctcccaccttccctggagtaaaaatcaaaataacacatggaaaggac
atttcagagttaccaaagggaaacaaagaagatagcctgaaaaaaattaaaaggacacct
tctgctacgtttcagcaagccacaaagattaaaaaattaagagcaggtaaactctctcct
ctcaagtctaagtttaagacagggaagcttcaaataggaaggaagggggtacaaattgta
cgacggagaggaaggcctccatcaacagaaaggataaagaccccttcgggtctcctcatt
aattctgaactggaaaagccccagaaagtccggaaagacaaggaaggaacacctccactt
acaaaagaagataagacagttgtcagacaaagccctcgaaggattaagccagttaggatt
attccttcttcaaaaaggacagatgcaaccattgctaagcaactcttacagagggcaaaa
aagggggctcaaaagaaaattgaaaaagaagcagctcagctgcagggaagaaaggtgaag
acacaggtcaaaaatattcgacagttcatcatgcctgttgtcagtgctatctcctcgcgg
atcattaagacccctcggcggtttatagaggatgaggattatgaccctccaattaaaatt
gcccgattagagtctacaccgaatagtagattcagtgccccgtcctgtggatcttctgaa
aaatcaagtgcagcttctcagcactcctctcaaatgtcttcagactcctctcgatctagt
agccccagtgttgatacctccacagactctcaggcttctgaggagattcaggtacttcct
gaggagcggagcgatacccctgaagttcatcctccactgcccatttcccagtccccagaa
aatgagagtaatgataggagaagcagaaggtattcagtgtcggagagaagttttggatct
agaacgacgaaaaaattatcaactctacaaagtgccccccagcagcagacctcctcgtct
ccacctccacctctgctgactccaccgccaccactgcagccagcctccagtatctctgac
cacacaccttggcttatgcctccaacaatccccttagcatcaccatttttgcctgcttcc
actgctcctatgcaagggaagcgaaaatctattttgcgagaaccgacatttaggtggact
tctttaaagcattctaggtcagagccacaatacttttcctcagcaaagtatgccaaagaa
ggtcttattcgcaaaccaatatttgataatttccgaccccctccactaactcccgaggac
gttggctttgcatctggtttttctgcatctggtaccgctgcttcagcccgattgttttcg
ccactccattctggaacaaggtttgatatgcacaaaaggagccctcttctgagagctcca
agatttactccaagtgaggctcactctagaatatttgagtctgtaaccttgcctagtaat
cgaacttctgctggaacatcttcttcaggagtatccaatagaaaaaggaaaagaaaagtg
tttagtcctattcgatctgaaccaagatctccttctcactccatgaggacaagaagtgga
aggcttagtagttctgagctctcacctctcacccccccgtcttctgtctcttcctcgtta
agcatttctgttagtcctcttgccactagtgccttaaacccaacttttacttttccttct
cattccctgactcagtctggggaatctgcagagaaaaatcagagaccaaggaagcagact
agtgctccggcagagccattttcatcaagtagtcctactcctctcttcccttggtttacc
ccaggctctcagactgaaagagggagaaataaagacaaggcccccgaggagctgtccaaa
gatcgagatgctgacaagagcgtggagaaggacaagagtagagagagagaccgggagaga
gaaaaggagaataagcgggagtcaaggaaagagaaaaggaaaaagggatcagaaattcag
agtagttctgctttgtatcctgtgggtagggtttccaaagagaaggttgttggtgaagat
gttgccacttcatcttctgccaaaaaagcaacagggcggaagaagtcttcatcacatgat
tctgggactgatattacttctgtgactcttggggatacaacagctgtcaaaaccaaaata
cttataaagaaagggagaggaaatctggaaaaaaccaacttggacctcggcccaactgcc
ccatccctggagaaggagaaaaccctctgcctttccactccttcatctagcactgttaaa
cattccacttcctccataggctccatgttggctcaggcagacaagcttccaatgactgac
aagagggttgccagcctcctaaaaaaggccaaagctcagctctgcaagattgagaagagt
aagagtcttaaacaaaccgaccagcccaaagcacagggtcaagaaagtgactcatcagag
acctctgtgcgaggaccccggattaaacatgtctgcagaagagcagctgttgcccttggc
cgaaaacgagctgtgtttcctgatgacatgcccaccctgagtgccttaccatgggaagaa
cgagaaaagattttgtcttccatggggaatgatgacaagtcatcaattgctggctcagaa
gatgctgaacctcttgctccacccatcaaaccaattaaacctgtcactagaaacaaggca
ccccaggaacctccagtaaagaaaggacgtcgatcgaggcggtgtgggcagtgtcccggc
tgccaggtgcctgaggactgtggtgtttgtactaattgcttagataagcccaagtttggt
ggtcgcaatataaagaagcagtgctgcaagatgagaaaatgtcagaatctacaatggatg
ccttccaaagcctacctgcagaagcaagctaaagctgtgaaaaagaaagagaaaaagtct
aagaccagtgaaaagaaagacagcaaagagagcagtgttgtgaagaacgtggtggactct
agtcagaaacctaccccatcagcaagagaggatcctgccccaaagaaaagcagtagtgag
cctcctccacgaaagcccgtcgaggaaaagagtgaagaagggaatgtctcggcccctggg
cctgaatccaaacaggccaccactccagcttccaggaagtcaagcaagcaggtctcccag
ccagcactggtcatcccgcctcagccacctactacaggaccgccaagaaaagaagttccc
aaaaccactcctagtgagcccaagaaaaagcagcctccaccaccagaatcaggtccagag
cagagcaaacagaaaaaagtggctccccgcccaagtatccctgtaaaacaaaaaccaaaa
gaaaaggaaaaaccacctccggtcaataagcaggagaatgcaggcactttgaacatcctc
agcactctctccaatggcaatagttctaagcaaaaaattccagcagatggagtccacagg
atcagagtggactttaaggaggattgtgaagcagaaaatgtgtgggagatgggaggctta
ggaatcttgacttctgttcctataacacccagggtggtttgctttctctgtgccagtagt
gggcatgtagagtttgtgtattgccaagtctgttgtgagcccttccacaagttttgttta
gaggagaacgagcgccctctggaggaccagctggaaaattggtgttgtcgtcgttgcaaa
ttctgtcacgtttgtggaaggcaacatcaggctacaaagcagctgctggagtgtaataag
tgccgaaacagctatcaccctgagtgcctgggaccaaactaccccaccaaacccacaaag
aagaagaaagtctggatctgtaccaagtgtgttcgctgtaagagctgtggatccacaact
ccaggcaaagggtgggatgcacagtggtctcatgatttctcactgtgtcatgattgcgcc
aagctctttgctaaaggaaacttctgccctctctgtgacaaatgttatgatgatgatgac
tatgagagtaagatgatgcaatgtggaaagtgtgatcgctgggtccattccaaatgtgag
aatctttcaggtacagaagatgagatgtatgagattctatctaatctgccagaaagtgtg
gcctacacttgtgtgaactgtactgagcggcaccctgcagagtggcgactggcccttgaa
aaagagctgcagatttctctgaagcaagttctgacagctttgttgaattctcggactacc
agccatttgctacgctaccggcaggctgccaagcctccagacttaaatcccgagacagag
gagagtataccttcccgcagctcccccgaaggacctgatccaccagttcttactgaggtc
agcaaacaggatgatcagcagcctttagatctagaaggagtcaagaggaagatggaccaa
gggaattacacatctgtgttggagttcagtgatgatattgtgaagatcattcaagcagcc
attaattcagatggaggacagccagaaattaaaaaagccaacagcatggtcaagtccttc
ttcattcggcaaatggaacgtgtttttccatggttcagtgtcaaaaagtccaggttttgg
gagccaaataaagtatcaagcaacagtgggatgttaccaaacgcagtgcttccaccttca
cttgaccataattatgctcagtggcaggagcgagaggaaaacagccacactgagcagcct
cctttaatgaagaaaatcattccagctcccaaacccaaaggtcctggagaaccagactca
ccaactcctctgcatcctcctacaccaccaattttgagtactgataggagtcgagaagac
agtccagagctgaacccacccccaggcatagaagacaatagacagtgtgcgttatgtttg
acttatggtgatgacagtgctaatgatgctggtcgtttactatatattggccaaaatgag
tggacacatgtaaattgtgctttgtggtcagcggaagtgtttgaagatgatgacggatca
ctaaagaatgtgcatatggctgtgatcaggggcaagcagctgagatgtgaattctgccaa
aagccaggagccaccgtgggttgctgtctcacatcctgcaccagcaactatcacttcatg
tgttcccgagccaagaactgtgtctttctggatgataaaaaagtatattgccaacgacat
cgggatttgatcaaaggcgaagtggttcctgagaatggatttgaagttttcagaagagtg
tttgtggactttgaaggaatcagcttgagaaggaagtttctcaatggcttggaaccagaa
aatatccacatgatgattgggtctatgacaatcgactgcttaggaattctaaatgatctc
tccgactgtgaagataagctctttcctattggatatcagtgttccagggtatactggagc
accacagatgctcgcaagcgctgtgtatatacatgcaagatagtggagtgccgtcctcca
gtcgtagagccggatatcaacagcactgttgaacatgatgaaaacaggaccattgcccat
agtccaacatcttttacagaaagttcatcaaaagagagtcaaaacacagctgaaattata
agtcctccatcaccagaccgacctcctcattcacaaacctctggctcctgttattatcat
gtcatctcaaaggtccccaggattcgaacacccagttattctccaacacagagatcccct
ggctgtcgaccgttgccttctgcaggaagtcctaccccaaccactcatgaaatagtcaca
gtaggtgatcctttactctcctctggacttcgaagcattggctccaggcgtcacagtacc
tcttccttatcaccccagcggtccaaactccggataatgtctccaatgagaactgggaat
acttactctaggaataatgtttcctcagtctccaccaccgggaccgctactgatcttgaa
tcaagtgccaaagtagttgatcatgtcttagggccactgaattcaagtactagtttaggg
caaaacacttccacctcttcaaatttgcaaaggacagtggttactgtaggcaataaaaac
agtcacttggatggatcttcatcttcagaaatgaagcagtccagtgcttcagacttggtg
tccaagagctcctctttaaagggagagaagaccaaagtgctgagttccaagagctcagag
ggatctgcacataatgtggcttaccctggaattcctaaactggccccacaggttcataac
acaacatctagagaactgaatgttagtaaaatcggctcctttgctgaaccctcttcagtg
tcgttttcttctaaagaggccctctccttcccacacctccatttgagagggcaaaggaat
gatcgagaccaacacacagattctacccaatcagcaaactcctctccagatgaagatact
gaagtcaaaaccttgaagctatctggaatgagcaacagatcatccattatcaacgaacat
atgggatctagttccagagataggagacagaaagggaaaaaatcctgtaaagaaactttc
aaagaaaagcattccagtaaatcttttttggaacctggtcaggtgacaactggtgaggaa
ggaaacttgaagccagagtttatggatgaggttttgactcctgagtatatgggccaacga
ccatgtaacaatgtttcttctgataagattggtgataaaggcctttctatgccaggagtc
cccaaagctccacccatgcaagtagaaggatctgccaaggaattacaggcaccacggaaa
cgcacagtcaaagtgacactgacacctctaaaaatggaaaatgagagtcaatccaaaaat
gccctgaaagaaagtagtcctgcttcccctttgcaaatagagtcaacatctcccacagaa
ccaatttcagcctctgaaaatccaggagatggtccagtggcccaaccaagccccaataat
acctcatgccaggattctcaaagtaacaactatcagaatcttccagtacaggacagaaac
ctaatgcttccagatggccccaaacctcaggaggatggctcttttaaaaggaggtatccc
cgtcgcagtgcccgtgcacgttctaacatgttttttgggcttaccccactctatggagta
agatcctatggtgaagaagacattccattctacagcagctcaactgggaagaagcgaggc
aagagatcagctgaaggacaggtggatggggccgatgacttaagcacttcagatgaagac
gacttatactattacaacttcactagaacagtgatttcttcaggtggagaggaacgactg
gcatcccataatttatttcgggaggaggaacagtgtgatcttccaaaaatctcacagttg
gatggtgttgatgatgggacagagagtgatactagtgtcacagccacaacaaggaaaagc
agccagattccaaaaagaaatggtaaagaaaatggaacagagaacttaaagattgataga
cctgaagatgctggggagaaagaacatgtcactaagagttctgttggccacaaaaatgag
ccaaagatggataactgccattctgtaagcagagttaaaacacagggacaagattccttg
gaagctcagctcagctcattggagtcaagccgcagagtccacacaagtaccccctccgac
aaaaatttactggacacctataatactgagctcctgaaatcagattcagacaataacaac
agtgatgactgtgggaatatcctgccttcagacattatggactttgtactaaagaatact
ccatccatgcaggctttgggtgagagcccagagtcatcttcatcagaactcctgaatctt
ggtgaaggattgggtcttgacagtaatcgtgaaaaagacatgggtctttttgaagtattt
tctcagcagctgcctacaacagaacctgtggatagtagtgtctcttcctctatctcagca
gaggaacagtttgagttgcctctagagctaccatctgatctgtctgtcttgaccacccgg
agtcccactgtccccagccagaatcccagtagactagctgttatctcagactcaggggag
aagagagtaaccatcacagaaaaatctgtagcctcctctgaaagtgacccagcactgctg
agcccaggagtagatccaactcctgaaggccacatgactcctgatcattttatccaagga
cacatggatgcagaccacatctctagccctccttgtggttcagtagagcaaggtcatggc
aacaatcaggatttaactaggaacagtagcacccctggccttcaggtacctgtttcccca
actgttcccatccagaaccagaagtatgtgcccaattctactgatagtcctggcccgtct
cagatttccaatgcagctgtccagaccactccaccccacctgaagccagccactgagaaa
ctcatagttgttaaccagaacatgcagccactttatgttctccaaactcttccaaatgga
gtgacccaaaaaatccaattgacctcttctgttagttctacacccagtgtgatggagaca
aatacttcagtattgggacccatgggaggtggtctcacccttaccacaggactaaatcca
agcttgccaacttctcaatctttgttcccttctgctagcaaaggattgctacccatgtct
catcaccagcacttacattccttccctgcagctactcaaagtagtttcccaccaaacatc
agcaatcctccttcaggcctgcttattggggttcagcctcctccggatccccaacttttg
gtttcagaatccagccagaggacagacctcagtaccacagtagccactccatcctctgga
ctcaagaaaagacccatatctcgtctacagacccgaaagaataaaaaacttgctccctct
agtaccccttcaaacattgccccttctgatgtggtttctaatatgacattgattaacttc
acaccctcccagcttcctaatcatccaagtctgttagatttggggtcacttaatacttca
tctcaccgaactgtccccaacatcataaaaagatctaaatctagcatcatgtattttgaa
ccggcacccctgttaccacagagtgtgggaggaactgctgccacagcggcaggcacatca
acaataagccaggatactagccacctcacatcagggtctgtgtctggcttggcatccagt
tcctctgtcttgaatgttgtatccatgcaaactaccacaacccctacaagtagtgcgtca
gttccaggacacgtcaccttaaccaacccaaggttgcttggtaccccagatattggctca
ataagcaatcttttaatcaaagctagccagcagagcctggggattcaggaccagcctgtg
gctttaccgccaagttcaggaatgtttccacaactggggacatcacagaccccctctact
gctgcaataacagcggcatctagcatctgtgtgctcccctccactcagactacgggcata
acagccgcttcaccttctggggaagcagacgaacactatcagcttcagcatgtgaaccag
ctccttgccagcaaaactgggattcattcttcccagcgtgatcttgattctgcttcaggg
ccccaggtatccaactttacccagacggtagacgctcctaatagcatgggactggagcag
aacaaggctttatcctcagctgtgcaagccagccccacctctcctgggggttctccatcc
tctccatcttctggacagcggtcagcaagcccttcagtgccgggtcccactaaacccaaa
ccaaaaaccaaacggtttcagctgcctctagacaaagggaatggcaagaagcacaaagtt
tcccatttgcggaccagttcttctgaagcacacattccagaccaagaaacgacatccctg
acctcaggcacagggactccaggagcagaggctgagcagcaggatacagctagcgtggag
cagtcctcccagaaggagtgtgggcaacctgcagggcaagtcgctgttcttccggaagtt
caggtgacccaaaatccagcaaatgaacaagaaagtgcagaacctaaaacagtggaagaa
gaggaaagtaatttcagctccccactgatgctttggcttcagcaagaacaaaagcggaag
gaaagcattactgagaaaaaacccaagaaaggacttgtttttgaaatttccagtgatgat
ggctttcagatctgtgcagaaagtattgaagatgcctggaagtcattgacagataaagtc
caggaagctcgatcaaatgcccgcctaaagcagctctcatttgcaggtgttaacggtttg
aggatgctggggattctccatgatgcagttgtgttcctcattgagcagctgtctggtgcc
aagcactgtcgaaattacaaattccgtttccacaagccagaggaggccaatgaacccccc
ttgaaccctcacggctcagccagggctgaagtccacctcaggaagtcagcatttgacatg
tttaacttcctggcttctaaacatcgtcagcctcctgaatacaaccccaatgatgaagaa
gaggaggaggtacagctgaagtcagctcggagggcaactagcatggatctgccaatgccc
atgcgcttccggcacttaaaaaagacttctaaggaggcagttggtgtctacaggtctccc
atccatggccggggtcttttctgtaagagaaacattgatgcaggtgagatggtgattgag
tatgccggcaacgtcatccgctccatccagactgacaagcgggaaaagtattacgacagc
aagggcattggttgctatatgttccgaattgatgactcagaggtagtggatgccaccatg
catggaaatgctgcacgcttcatcaatcactcgtgtgagcctaactgctattctcgggtc
atcaatattgatgggcagaagcacattgtcatctttgccatgcgtaagatctaccgagga
gaggaactcacttacgactataagttccccattgaggatgccagcaacaagctgccctgc
aactgtggcgccaagaaatgccggaagttcctaaactaa

DBGET integrated database retrieval system