KEGG   Homo sapiens (human): 4297Help
Entry
4297              CDS       T01001                                 

Gene name
KMT2A, ALL-1, CXXC7, HRX, HTRX1, MLL, MLL-AF9, MLL/GAS7, MLL1, MLL1A, TET1-MLL, TRX1, WDSTS
Definition
(RefSeq) lysine methyltransferase 2A
  KO
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia/lymphoma)
H00002  
Acute lymphoblastic leukemia (ALL) (precursor T lymphoblastic leukemia/lymphoma)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    4297 (KMT2A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4297 (KMT2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     4297 (KMT2A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    4297 (KMT2A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     4297 (KMT2A)
   HMT complexes
    MLL-HCF complex
     4297 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 3969 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKD
ISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSS
SPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPED
VGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSL
SISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKI
LIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTD
KRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKA
PQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVP
KTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNIL
STLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASS
GHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNK
CRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCA
KLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYT
CVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESI
PSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINS
DGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDH
NYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPE
LNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKN
VHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDL
IKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDC
EDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPT
SFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCR
PLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYS
RNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHL
DGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTS
RELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVK
TLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNL
KPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTV
KVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSC
QDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSY
GEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASH
NLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPED
AGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNL
LDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEG
LGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPT
VPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMD
ADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQIS
NAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTS
VLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNP
PSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTP
SNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAP
LLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPG
HVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAI
TAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQV
SNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKT
KRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSS
QKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESI
TEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRML
GILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNF
LASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHG
RGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGN
AARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCG
AKKCRKFLN
NT seq 11910 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcgccggggcctagggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgtg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagaggatgagcaattcttaggttttggctcagatgaagaagtcagagtgcga
agtcccacaaggtctccttcagttaaaactagtcctcgaaaacctcgtgggagacctaga
agtggctctgaccgaaattcagctatcctctcagatccatctgtgttttcccctctaaat
aaatcagagaccaaatctggagataagatcaagaagaaagattctaaaagtatagaaaag
aagagaggaagacctcccaccttccctggagtaaaaatcaaaataacacatggaaaggac
atttcagagttaccaaagggaaacaaagaagatagcctgaaaaaaattaaaaggacacct
tctgctacgtttcagcaagccacaaagattaaaaaattaagagcaggtaaactctctcct
ctcaagtctaagtttaagacagggaagcttcaaataggaaggaagggggtacaaattgta
cgacggagaggaaggcctccatcaacagaaaggataaagaccccttcgggtctcctcatt
aattctgaactggaaaagccccagaaagtccggaaagacaaggaaggaacacctccactt
acaaaagaagataagacagttgtcagacaaagccctcgaaggattaagccagttaggatt
attccttcttcaaaaaggacagatgcaaccattgctaagcaactcttacagagggcaaaa
aagggggctcaaaagaaaattgaaaaagaagcagctcagctgcagggaagaaaggtgaag
acacaggtcaaaaatattcgacagttcatcatgcctgttgtcagtgctatctcctcgcgg
atcattaagacccctcggcggtttatagaggatgaggattatgaccctccaattaaaatt
gcccgattagagtctacaccgaatagtagattcagtgccccgtcctgtggatcttctgaa
aaatcaagtgcagcttctcagcactcctctcaaatgtcttcagactcctctcgatctagt
agccccagtgttgatacctccacagactctcaggcttctgaggagattcaggtacttcct
gaggagcggagcgatacccctgaagttcatcctccactgcccatttcccagtccccagaa
aatgagagtaatgataggagaagcagaaggtattcagtgtcggagagaagttttggatct
agaacgacgaaaaaattatcaactctacaaagtgccccccagcagcagacctcctcgtct
ccacctccacctctgctgactccaccgccaccactgcagccagcctccagtatctctgac
cacacaccttggcttatgcctccaacaatccccttagcatcaccatttttgcctgcttcc
actgctcctatgcaagggaagcgaaaatctattttgcgagaaccgacatttaggtggact
tctttaaagcattctaggtcagagccacaatacttttcctcagcaaagtatgccaaagaa
ggtcttattcgcaaaccaatatttgataatttccgaccccctccactaactcccgaggac
gttggctttgcatctggtttttctgcatctggtaccgctgcttcagcccgattgttttcg
ccactccattctggaacaaggtttgatatgcacaaaaggagccctcttctgagagctcca
agatttactccaagtgaggctcactctagaatatttgagtctgtaaccttgcctagtaat
cgaacttctgctggaacatcttcttcaggagtatccaatagaaaaaggaaaagaaaagtg
tttagtcctattcgatctgaaccaagatctccttctcactccatgaggacaagaagtgga
aggcttagtagttctgagctctcacctctcacccccccgtcttctgtctcttcctcgtta
agcatttctgttagtcctcttgccactagtgccttaaacccaacttttacttttccttct
cattccctgactcagtctggggaatctgcagagaaaaatcagagaccaaggaagcagact
agtgctccggcagagccattttcatcaagtagtcctactcctctcttcccttggtttacc
ccaggctctcagactgaaagagggagaaataaagacaaggcccccgaggagctgtccaaa
gatcgagatgctgacaagagcgtggagaaggacaagagtagagagagagaccgggagaga
gaaaaggagaataagcgggagtcaaggaaagagaaaaggaaaaagggatcagaaattcag
agtagttctgctttgtatcctgtgggtagggtttccaaagagaaggttgttggtgaagat
gttgccacttcatcttctgccaaaaaagcaacagggcggaagaagtcttcatcacatgat
tctgggactgatattacttctgtgactcttggggatacaacagctgtcaaaaccaaaata
cttataaagaaagggagaggaaatctggaaaaaaccaacttggacctcggcccaactgcc
ccatccctggagaaggagaaaaccctctgcctttccactccttcatctagcactgttaaa
cattccacttcctccataggctccatgttggctcaggcagacaagcttccaatgactgac
aagagggttgccagcctcctaaaaaaggccaaagctcagctctgcaagattgagaagagt
aagagtcttaaacaaaccgaccagcccaaagcacagggtcaagaaagtgactcatcagag
acctctgtgcgaggaccccggattaaacatgtctgcagaagagcagctgttgcccttggc
cgaaaacgagctgtgtttcctgatgacatgcccaccctgagtgccttaccatgggaagaa
cgagaaaagattttgtcttccatggggaatgatgacaagtcatcaattgctggctcagaa
gatgctgaacctcttgctccacccatcaaaccaattaaacctgtcactagaaacaaggca
ccccaggaacctccagtaaagaaaggacgtcgatcgaggcggtgtgggcagtgtcccggc
tgccaggtgcctgaggactgtggtgtttgtactaattgcttagataagcccaagtttggt
ggtcgcaatataaagaagcagtgctgcaagatgagaaaatgtcagaatctacaatggatg
ccttccaaagcctacctgcagaagcaagctaaagctgtgaaaaagaaagagaaaaagtct
aagaccagtgaaaagaaagacagcaaagagagcagtgttgtgaagaacgtggtggactct
agtcagaaacctaccccatcagcaagagaggatcctgccccaaagaaaagcagtagtgag
cctcctccacgaaagcccgtcgaggaaaagagtgaagaagggaatgtctcggcccctggg
cctgaatccaaacaggccaccactccagcttccaggaagtcaagcaagcaggtctcccag
ccagcactggtcatcccgcctcagccacctactacaggaccgccaagaaaagaagttccc
aaaaccactcctagtgagcccaagaaaaagcagcctccaccaccagaatcaggtccagag
cagagcaaacagaaaaaagtggctccccgcccaagtatccctgtaaaacaaaaaccaaaa
gaaaaggaaaaaccacctccggtcaataagcaggagaatgcaggcactttgaacatcctc
agcactctctccaatggcaatagttctaagcaaaaaattccagcagatggagtccacagg
atcagagtggactttaaggaggattgtgaagcagaaaatgtgtgggagatgggaggctta
ggaatcttgacttctgttcctataacacccagggtggtttgctttctctgtgccagtagt
gggcatgtagagtttgtgtattgccaagtctgttgtgagcccttccacaagttttgttta
gaggagaacgagcgccctctggaggaccagctggaaaattggtgttgtcgtcgttgcaaa
ttctgtcacgtttgtggaaggcaacatcaggctacaaagcagctgctggagtgtaataag
tgccgaaacagctatcaccctgagtgcctgggaccaaactaccccaccaaacccacaaag
aagaagaaagtctggatctgtaccaagtgtgttcgctgtaagagctgtggatccacaact
ccaggcaaagggtgggatgcacagtggtctcatgatttctcactgtgtcatgattgcgcc
aagctctttgctaaaggaaacttctgccctctctgtgacaaatgttatgatgatgatgac
tatgagagtaagatgatgcaatgtggaaagtgtgatcgctgggtccattccaaatgtgag
aatctttcagatgagatgtatgagattctatctaatctgccagaaagtgtggcctacact
tgtgtgaactgtactgagcggcaccctgcagagtggcgactggcccttgaaaaagagctg
cagatttctctgaagcaagttctgacagctttgttgaattctcggactaccagccatttg
ctacgctaccggcaggctgccaagcctccagacttaaatcccgagacagaggagagtata
ccttcccgcagctcccccgaaggacctgatccaccagttcttactgaggtcagcaaacag
gatgatcagcagcctttagatctagaaggagtcaagaggaagatggaccaagggaattac
acatctgtgttggagttcagtgatgatattgtgaagatcattcaagcagccattaattca
gatggaggacagccagaaattaaaaaagccaacagcatggtcaagtccttcttcattcgg
caaatggaacgtgtttttccatggttcagtgtcaaaaagtccaggttttgggagccaaat
aaagtatcaagcaacagtgggatgttaccaaacgcagtgcttccaccttcacttgaccat
aattatgctcagtggcaggagcgagaggaaaacagccacactgagcagcctcctttaatg
aagaaaatcattccagctcccaaacccaaaggtcctggagaaccagactcaccaactcct
ctgcatcctcctacaccaccaattttgagtactgataggagtcgagaagacagtccagag
ctgaacccacccccaggcatagaagacaatagacagtgtgcgttatgtttgacttatggt
gatgacagtgctaatgatgctggtcgtttactatatattggccaaaatgagtggacacat
gtaaattgtgctttgtggtcagcggaagtgtttgaagatgatgacggatcactaaagaat
gtgcatatggctgtgatcaggggcaagcagctgagatgtgaattctgccaaaagccagga
gccaccgtgggttgctgtctcacatcctgcaccagcaactatcacttcatgtgttcccga
gccaagaactgtgtctttctggatgataaaaaagtatattgccaacgacatcgggatttg
atcaaaggcgaagtggttcctgagaatggatttgaagttttcagaagagtgtttgtggac
tttgaaggaatcagcttgagaaggaagtttctcaatggcttggaaccagaaaatatccac
atgatgattgggtctatgacaatcgactgcttaggaattctaaatgatctctccgactgt
gaagataagctctttcctattggatatcagtgttccagggtatactggagcaccacagat
gctcgcaagcgctgtgtatatacatgcaagatagtggagtgccgtcctccagtcgtagag
ccggatatcaacagcactgttgaacatgatgaaaacaggaccattgcccatagtccaaca
tcttttacagaaagttcatcaaaagagagtcaaaacacagctgaaattataagtcctcca
tcaccagaccgacctcctcattcacaaacctctggctcctgttattatcatgtcatctca
aaggtccccaggattcgaacacccagttattctccaacacagagatcccctggctgtcga
ccgttgccttctgcaggaagtcctaccccaaccactcatgaaatagtcacagtaggtgat
cctttactctcctctggacttcgaagcattggctccaggcgtcacagtacctcttcctta
tcaccccagcggtccaaactccggataatgtctccaatgagaactgggaatacttactct
aggaataatgtttcctcagtctccaccaccgggaccgctactgatcttgaatcaagtgcc
aaagtagttgatcatgtcttagggccactgaattcaagtactagtttagggcaaaacact
tccacctcttcaaatttgcaaaggacagtggttactgtaggcaataaaaacagtcacttg
gatggatcttcatcttcagaaatgaagcagtccagtgcttcagacttggtgtccaagagc
tcctctttaaagggagagaagaccaaagtgctgagttccaagagctcagagggatctgca
cataatgtggcttaccctggaattcctaaactggccccacaggttcataacacaacatct
agagaactgaatgttagtaaaatcggctcctttgctgaaccctcttcagtgtcgttttct
tctaaagaggccctctccttcccacacctccatttgagagggcaaaggaatgatcgagac
caacacacagattctacccaatcagcaaactcctctccagatgaagatactgaagtcaaa
accttgaagctatctggaatgagcaacagatcatccattatcaacgaacatatgggatct
agttccagagataggagacagaaagggaaaaaatcctgtaaagaaactttcaaagaaaag
cattccagtaaatcttttttggaacctggtcaggtgacaactggtgaggaaggaaacttg
aagccagagtttatggatgaggttttgactcctgagtatatgggccaacgaccatgtaac
aatgtttcttctgataagattggtgataaaggcctttctatgccaggagtccccaaagct
ccacccatgcaagtagaaggatctgccaaggaattacaggcaccacggaaacgcacagtc
aaagtgacactgacacctctaaaaatggaaaatgagagtcaatccaaaaatgccctgaaa
gaaagtagtcctgcttcccctttgcaaatagagtcaacatctcccacagaaccaatttca
gcctctgaaaatccaggagatggtccagtggcccaaccaagccccaataatacctcatgc
caggattctcaaagtaacaactatcagaatcttccagtacaggacagaaacctaatgctt
ccagatggccccaaacctcaggaggatggctcttttaaaaggaggtatccccgtcgcagt
gcccgtgcacgttctaacatgttttttgggcttaccccactctatggagtaagatcctat
ggtgaagaagacattccattctacagcagctcaactgggaagaagcgaggcaagagatca
gctgaaggacaggtggatggggccgatgacttaagcacttcagatgaagacgacttatac
tattacaacttcactagaacagtgatttcttcaggtggagaggaacgactggcatcccat
aatttatttcgggaggaggaacagtgtgatcttccaaaaatctcacagttggatggtgtt
gatgatgggacagagagtgatactagtgtcacagccacaacaaggaaaagcagccagatt
ccaaaaagaaatggtaaagaaaatggaacagagaacttaaagattgatagacctgaagat
gctggggagaaagaacatgtcactaagagttctgttggccacaaaaatgagccaaagatg
gataactgccattctgtaagcagagttaaaacacagggacaagattccttggaagctcag
ctcagctcattggagtcaagccgcagagtccacacaagtaccccctccgacaaaaattta
ctggacacctataatactgagctcctgaaatcagattcagacaataacaacagtgatgac
tgtgggaatatcctgccttcagacattatggactttgtactaaagaatactccatccatg
caggctttgggtgagagcccagagtcatcttcatcagaactcctgaatcttggtgaagga
ttgggtcttgacagtaatcgtgaaaaagacatgggtctttttgaagtattttctcagcag
ctgcctacaacagaacctgtggatagtagtgtctcttcctctatctcagcagaggaacag
tttgagttgcctctagagctaccatctgatctgtctgtcttgaccacccggagtcccact
gtccccagccagaatcccagtagactagctgttatctcagactcaggggagaagagagta
accatcacagaaaaatctgtagcctcctctgaaagtgacccagcactgctgagcccagga
gtagatccaactcctgaaggccacatgactcctgatcattttatccaaggacacatggat
gcagaccacatctctagccctccttgtggttcagtagagcaaggtcatggcaacaatcag
gatttaactaggaacagtagcacccctggccttcaggtacctgtttccccaactgttccc
atccagaaccagaagtatgtgcccaattctactgatagtcctggcccgtctcagatttcc
aatgcagctgtccagaccactccaccccacctgaagccagccactgagaaactcatagtt
gttaaccagaacatgcagccactttatgttctccaaactcttccaaatggagtgacccaa
aaaatccaattgacctcttctgttagttctacacccagtgtgatggagacaaatacttca
gtattgggacccatgggaggtggtctcacccttaccacaggactaaatccaagcttgcca
acttctcaatctttgttcccttctgctagcaaaggattgctacccatgtctcatcaccag
cacttacattccttccctgcagctactcaaagtagtttcccaccaaacatcagcaatcct
ccttcaggcctgcttattggggttcagcctcctccggatccccaacttttggtttcagaa
tccagccagaggacagacctcagtaccacagtagccactccatcctctggactcaagaaa
agacccatatctcgtctacagacccgaaagaataaaaaacttgctccctctagtacccct
tcaaacattgccccttctgatgtggtttctaatatgacattgattaacttcacaccctcc
cagcttcctaatcatccaagtctgttagatttggggtcacttaatacttcatctcaccga
actgtccccaacatcataaaaagatctaaatctagcatcatgtattttgaaccggcaccc
ctgttaccacagagtgtgggaggaactgctgccacagcggcaggcacatcaacaataagc
caggatactagccacctcacatcagggtctgtgtctggcttggcatccagttcctctgtc
ttgaatgttgtatccatgcaaactaccacaacccctacaagtagtgcgtcagttccagga
cacgtcaccttaaccaacccaaggttgcttggtaccccagatattggctcaataagcaat
cttttaatcaaagctagccagcagagcctggggattcaggaccagcctgtggctttaccg
ccaagttcaggaatgtttccacaactggggacatcacagaccccctctactgctgcaata
acagcggcatctagcatctgtgtgctcccctccactcagactacgggcataacagccgct
tcaccttctggggaagcagacgaacactatcagcttcagcatgtgaaccagctccttgcc
agcaaaactgggattcattcttcccagcgtgatcttgattctgcttcagggccccaggta
tccaactttacccagacggtagacgctcctaatagcatgggactggagcagaacaaggct
ttatcctcagctgtgcaagccagccccacctctcctgggggttctccatcctctccatct
tctggacagcggtcagcaagcccttcagtgccgggtcccactaaacccaaaccaaaaacc
aaacggtttcagctgcctctagacaaagggaatggcaagaagcacaaagtttcccatttg
cggaccagttcttctgaagcacacattccagaccaagaaacgacatccctgacctcaggc
acagggactccaggagcagaggctgagcagcaggatacagctagcgtggagcagtcctcc
cagaaggagtgtgggcaacctgcagggcaagtcgctgttcttccggaagttcaggtgacc
caaaatccagcaaatgaacaagaaagtgcagaacctaaaacagtggaagaagaggaaagt
aatttcagctccccactgatgctttggcttcagcaagaacaaaagcggaaggaaagcatt
actgagaaaaaacccaagaaaggacttgtttttgaaatttccagtgatgatggctttcag
atctgtgcagaaagtattgaagatgcctggaagtcattgacagataaagtccaggaagct
cgatcaaatgcccgcctaaagcagctctcatttgcaggtgttaacggtttgaggatgctg
gggattctccatgatgcagttgtgttcctcattgagcagctgtctggtgccaagcactgt
cgaaattacaaattccgtttccacaagccagaggaggccaatgaaccccccttgaaccct
cacggctcagccagggctgaagtccacctcaggaagtcagcatttgacatgtttaacttc
ctggcttctaaacatcgtcagcctcctgaatacaaccccaatgatgaagaagaggaggag
gtacagctgaagtcagctcggagggcaactagcatggatctgccaatgcccatgcgcttc
cggcacttaaaaaagacttctaaggaggcagttggtgtctacaggtctcccatccatggc
cggggtcttttctgtaagagaaacattgatgcaggtgagatggtgattgagtatgccggc
aacgtcatccgctccatccagactgacaagcgggaaaagtattacgacagcaagggcatt
ggttgctatatgttccgaattgatgactcagaggtagtggatgccaccatgcatggaaat
gctgcacgcttcatcaatcactcgtgtgagcctaactgctattctcgggtcatcaatatt
gatgggcagaagcacattgtcatctttgccatgcgtaagatctaccgaggagaggaactc
acttacgactataagttccccattgaggatgccagcaacaagctgccctgcaactgtggc
gccaagaaatgccggaagttcctaaactaa

DBGET integrated database retrieval system