KEGG   Homo sapiens (human): 4300Help
Entry
4300              CDS       T01001                                 

Gene name
MLLT3, AF9, YEATS3
Definition
(RefSeq) MLLT3, super elongation complex subunit
  KO
K15187  
YEATS domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4300 (MLLT3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     4300 (MLLT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P42568(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9p21.3
AA seq 568 aa AA seqDB search
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFP
RPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCE
KLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENK
PLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKK
SSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVD
PNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILE
VKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITN
TTFDFDLCSLDKTTVRKLQSYLETSGTS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggctagctcgtgtgccgtgcaggtgaagctggagctggggcaccgcgcccaggtgagg
aaaaaacccaccgtggagggcttcacccacgactggatggtgttcgtacgcggtccggag
cacagtaacatacagcactttgtggagaaagtcgtcttccacttgcacgaaagctttcct
aggccaaaaagagtgtgcaaagatccaccttacaaagtagaagaatctgggtatgctggt
ttcattttgccaattgaagtttattttaaaaacaaggaagaacctaggaaagtccgcttt
gattatgacttattcctgcatcttgaaggccatccaccagtgaatcacctccgctgtgaa
aagctaactttcaacaaccccacagaggactttaggagaaagttgctgaaggcaggaggg
gaccctaataggagtattcataccagcagcagcagcagcagcagcagtagcagcagcagc
agcagcagcagcagcagcagtagcagcagcagcagcagcagcagcagcagcagtagcagc
agcagtagcagcagcagcagcagcagtagtaccagtttttcaaagcctcacaaattaatg
aaggagcacaaggaaaaaccttctaaagactccagagaacataaaagtgccttcaaagaa
ccttccagggatcacaacaaatcttccaaagaatcctctaagaaacccaaagaaaataaa
ccactgaaagaagagaaaatagttcctaagatggccttcaaggaacctaaacccatgtca
aaagagccaaaaccagatagtaacttactcaccatcaccagtggacaagataagaaggct
cctagtaaaaggccgcccatttcagattctgaagaactctcagccaaaaaaaggaaaaag
agtagctcagaggctttatttaaaagtttttctagcgcaccaccactgatactcacttgt
tctgctgacaaaaaacagataaaagataaatctcatgtcaagatgggaaaggtcaaaatt
gaaagtgagacatcagagaagaagaaatcaacgttaccgccatttgatgatattgtggat
cccaatgattcagatgtggaggagaatatatcctctaaatctgattctgaacaacccagt
cctgccagctccagctccagctccagctccagcttcacaccatcccagaccaggcaacaa
ggtcctttgaggtctataatgaaagatctgcattctgatgacaatgaggaggaatcagat
gaagtggaggataacgacaatgactctgaaatggagaggcctgtaaatagaggaggcagc
cgaagtcgcagagttagcttaagtgatggcagcgatagtgaaagcagttctgcttcttca
cccctacatcacgaacctccaccacccttactaaaaaccaacaacaaccagattcttgaa
gtgaaaagtccaataaagcaaagcaaatcagataagcaaataaagaatggtgaatgtgac
aaggcatacctagatgaactggtagagcttcacagaaggttaatgacattgagagaaaga
cacattctgcagcagatcgtgaaccttatagaagaaactggacactttcatatcacaaac
acaacatttgattttgatctttgctcgctggacaaaaccacagtccgtaaactacagagt
tacctggaaacatctggaacatcctga

DBGET integrated database retrieval system