KEGG   Homo sapiens (human): 4301Help
Entry
4301              CDS       T01001                                 

Gene name
MLLT4, AF6, MLL-AF6
Definition
(RefSeq) myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4
  KO
K05702  
afadin
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Adherens junction
Tight junction
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4301 (MLLT4)
   04015 Rap1 signaling pathway
    4301 (MLLT4)
   04024 cAMP signaling pathway
    4301 (MLLT4)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    4301 (MLLT4)
   04530 Tight junction
    4301 (MLLT4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4301 (MLLT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q27
AA seq 1781 aa AA seqDB search
MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEE
RRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTL
SKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVV
MKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEA
LEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVF
QLKRRPPDHIPKKTKKHLEGKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAYY
NYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTV
TPRSMDAETYVEGQRISETTMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLMVKG
PRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQ
PDYRRQESRTQDASGPELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMA
CRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNF
IKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDD
VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQ
QLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQAL
LQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYS
CDVVRNIPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPL
RKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSV
DGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGK
PRPKSEGFELYNNSTQNGSPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPP
SPGGKSAYASGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDR
MAPPQNQWPNYEEKPHMHTDSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSD
SDMWINQSSSLDSSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIR
TDLPPPPPPPPVHYAGDFDGMSMDLPLPPPPSANQIGLPSAQVAAAERRKREEHQRWYEK
EKARLEEERERKRREQERKLGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQETVIREL
QPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQ
ELQSKPDRSAEESDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAER
RARDEERRRQQQLEEMRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAE
RRRQHDEAARRLLEPEAPGLCRPPLPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVLSPD
SLFTAKFVAYNEEEEEEDCSLAGPNSYPGSTGAAVGAHDACRDAKEKRSKSQDADSPGSS
GAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENELNTK
NT seq 5346 nt NT seq  +upstreamnt  +downstreamnt
atgagattttattttcaagataaagctgctggaaactttgcaacaaaatgtattcgggtc
tctagtactgccaccactcaagatgtaatcgaaacgctcgcggagaaatttcgacctgat
atgcgaatgctgtcctctcccaagtattcactctatgaagtgcatgtcagcggagaagaa
agaagattggatatagatgagaaacctctagttgtacaactgaattggaacaaagatgat
cgggaaggcagatttgttcttaagaatgagaatgacgccattcctcctaagaaggctcaa
agtaatggacctgaaaagcaggaaaaagaaggggttatccagaacttcaagagaactctc
tcaaagaaagaaaagaaggaaaaaaagaagagagaaaaagaggcattgcgacaggcatct
gataaagatgatagacctttccaaggggaggatgttgaaaattctcgactggctgctgag
gtttacaaagacatgccggaaaccagctttactcgaaccatttctaatcctgaggtggtt
atgaaacgacggaggcagcaaaaattggaaaagagaatgcaggaatttcggagctcagat
gggcggcctgattcaggtggaacattgagaatttatgcagatagtttaaaaccaaatatt
ccctacaagacaatcctgctgtctactacagatcctgcagactttgctgtggctgaagct
ttagagaagtatggtctggaaaaagaaaaccctaaggattactgcatcgcccgggttatg
cttcctcctggagcccagcattctgatgaaaagggtgctaaagaaattattcttgatgat
gatgagtgtcctttacaaatcttcagggaatggccaagtgacaaagggattttagtcttt
cagttgaagaggaggccaccagaccacatcccaaagaaaaccaagaaacacttggaaggc
aagacacccaagggaaaggagagagctgacgggtctggctatggctccacccttcctccg
gagaagctgccctatttagtagagttaagcccagggagaaggaatcactttgcctactac
aactatcacacttacgaagatggttctgactctagagataagccaaagctttaccgcctt
cagttaagtgttactgaagttgggacagaaaagttggatgacaactctatccagttgttt
ggcccaggaattcagccccatcactgtgaccttaccaacatggatggagtggtcactgtg
acgcccagaagtatggacgcagaaacctacgtggaaggccagcgcatctcagaaaccacc
atgctgcagagtggcatgaaagtgcagtttggggcgtcccatgtatttaagtttgtggac
cccagtcaggatcatgctcttgcaaaaagatctgtggatggaggcctgatggttaagggc
ccaagacataaacctggaattgttcaggagacaacttttgatttgggaggagatattcat
agtgggacagcattaccgacaagcaagagcaccactaggctggacagcgacagagtgtcg
tctgcctctagcacagccgagcggggaatggtgaagccgatgatcagagtagaacagcag
ccagattatcgcaggcaagaaagcagaacacaggatgcttctgggcctgagctgatacta
cctgcaagcattgaattcagggaaagttctgaagattcatttttgtctgccattataaat
tatactaatagctctacagtccactttaagttgtcccctacatatgtattatatatggca
tgccggtatgtattgtccaaccagtacagacctgacatcagccctacagagcgcacacat
aaagtcattgcagtcgtcaacaagatggtgagcatgatggagggtgtcatccagaaacag
aagaatattgcaggggcacttgccttctggatggcaaatgcatctgaacttctcaacttc
attaagcaagaccgagaccttagtcggatcacactggatgctcaagatgttttagcacat
ttggttcaaatggcatttaaatacttggttcactgtcttcaatcagaacttaataattac
atgccagcctttctagatgaccctgaagagaacagtctgcaacgaccaaaaatagatgat
gtgctgcacacgctcacaggagccatgtccttgctacgacgctgcagagtcaatgccgcc
ctgaccatccagctcttctctcagctcttccacttcatcaatatgtggctgttcaataga
ttggtgaccgacccagattcggggctgtgctcccattactggggtgcgattatccgtcag
cagttgggccatattgaagcctgggctgagaagcaggggctggaactggctgcggactgt
catctgagcaggatcgtgcaggcaacgactttgcttaccatggataagtatgcacctgat
gacattccaaatataaacagcacctgctttaagttaaattcattacaacttcaagcctta
ttacagaactatcactgtgcacctgatgagccttttatcccaacggatcttatagaaaat
gtagtgactgtggctgaaaacactgccgatgagctggcccgcagtgatggaagggaagtg
cagttggaggaggatcctgatctgcagctgccgtttcttttgccagaagatggttattct
tgtgatgttgtcagaaacattccaaatggtttacaagaatttttagaccctctgtgccag
agaggattttgcaggttaattcctcacacacgttcaccaggtacttggacaatatatttt
gaaggtgcagattatgaaagtcaccttctgcgtgagaacacagagctggctcagcctctg
aggaaagaacctgaaataatcactgtgaccctaaaaaagcagaatggaatgggccttagc
attgttgcagcaaagggtgctggtcaagataaactaggaatctatgtgaagtcggttgtg
aaaggaggtgctgcagatgtggatggacgtctagctgcaggtgatcagctcctcagtgtg
gatggacgaagtctggttggactctctcaggaaagggcggcagaactcatgacaagaaca
agctctgtggtgacactggaagtagcaaagcagggtgccatctaccacggtctggccacc
cttctcaatcagccatcccccatgatgcagagaatttcagatcgtcgtggctcaggtaaa
ccccgaccaaagagtgaaggctttgagctctataataattcaactcaaaatgggtctcct
gagagtcctcagctgccttgggcagaatatagtgaaccaaagaaattgcctggtgatgac
agactgatgaaaaatagagctgatcaccgttccagccccaacgtagcaaatcagcctcct
agtcctggagggaaaagtgcatatgcctctggaacaacagcgaagataacatctgtctct
actggaaacctctgcactgaggagcagacgcctccgcctagacctgaagcctaccccatc
cccactcagacgtacaccagagagtattttaccttcccagcttccaaatcccaggatcgg
atggctcctcctcagaaccagtggccaaattatgaggaaaagccacatatgcacacagat
agtaatcattccagtattgcaattcagcgtgttacacgttcccaagaagaacttcgagaa
gataaagcttaccaacttgagcggcatcgaatagaggcagctatggaccgaaagtctgat
agtgatatgtggataaatcagagctcctcactggactccagtacctctagccaggagcat
ctgaaccattcctctaagtcggtcacccctgcttccacactgaccaaaagtggccctggc
cgttggaaaacaccagcagccataccggccacccctgtggccgtctcccagccaatccga
acagacctgcctccgccacccccgccacctccagtccactatgccggtgatttcgatgga
atgtccatggatttgcctctcccaccacccccttccgccaaccagatagggctgccgtct
gcgcaggtggctgctgctgaacggagaaagagagaagaacatcagcgttggtatgagaag
gagaaggcccgcctggaggaggagcgggagaggaagcggagagagcaggagaggaagttg
ggccagatgcgcactcagtccttaaaccctgctccgttttctcccctgactgcacagcag
atgaagcccgaaaagccttccacactccagcggccacaggaaacagtcattcgggagctg
cagcctcagcagcagccccgcacgatcgagcgcagagacttgcagtacattacagtcagc
aaagaggagctttcctcgggggacagtctgtcccccgacccgtggaagcgggacgccaag
gagaagctggagaagcagcagcagatgcacatcgtggacatgctgagcaaggagatccag
gagctccagagcaaaccggaccgcagcgccgaggagagcgaccggctgcgcaagctcatg
ctggagtggcagttccagaagagactccaggagtcgaagcagaaggacgaagatgacgag
gaggaggaggacgatgatgtggacaccatgctgatcatgcagcgcctggaggctgaacga
agagcgagggacgaggagcggaggcggcagcagcagttagaagagatgcgcaagcgggaa
gcggaagaccgagcgaggcaagaggaagagcgccggcggcaggaggaggagcgaacaaaa
cgagacgctgaagaaaagaggcgacaggaagaagggtattacagccgcctggaagccgag
aggcgcagacagcacgacgaggcggcgcgcaggttgctggagcccgaggcgcccggtctg
tgccgccctccgcttccccgggactacgagcccccgtccccgtcccccgcgcccggcgcc
cctcctcccccgcctcagcgaaacgcctcctacctcaaaacacaggtcctctcccccgac
tcgctgttcactgccaagtttgttgcatacaatgaggaggaggaggaggaggactgcagc
ctagcaggaccaaactcttacccaggatctactggagcagctgttggagcccatgacgcc
tgtcgggatgcaaaagagaagcgctctaaaagccaagatgcagattcacctggaagttct
ggggcccctgaaaacttgacattcaaggaacgccagcgtcttttttcacaaggtcaagat
gtatccaataaagtgaaagcttctcgtaaattaacagaactggagaatgaactgaacaca
aagtga

DBGET integrated database retrieval system