KEGG   Homo sapiens (human): 4301Help
Entry
4301              CDS       T01001                                 

Gene name
MLLT4, AF6, RP3-431P23.3
Definition
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4
Orthology
K05702  
afadin
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Adherens junction
Tight junction
Leukocyte transendothelial migration
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q27
AA seq 1651 aa AA seqDB search
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQA
SDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARV
MLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLE
GKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLYR
LQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISET
TMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDI
HSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPELI
LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERT
HKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLA
HLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNA
ALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAAD
CHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIE
NVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLC
QRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGL
SIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTR
TSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSTQNGS
PESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYASGTTAKITSV
STGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHMHT
DSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSLDSSTSSQE
HLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPPVHYAGDFD
GMSMDLPLPPPPSANQIGLPSAQVAAAERRKREEHQRWYEKEKARLEEERERKRREQERK
LGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITV
SKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKL
MLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARDEERRRQQQLEEMRKR
EAEDRARQEEERRRQEEERTKRDAEEKVMVL
NT seq 4956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgggcggccgtgacgaggagcggcggaagctggccgacatcatccaccactgg
aacgccaaccggctggacctgttcgagatcagccagccgaccgaggatttggagttccat
ggagtgatgagattttattttcaagataaagctgctggaaactttgcaacaaaatgtatt
cgggtctctagtactgccaccactcaagatgtaatcgaaacgctcgcggagaaatttcga
cctgatatgcgaatgctgtcctctcccaagtattcactctatgaagtgcatgtcagcgga
gaaagaagattggatatagatgagaaacctctagttgtacaactgaattggaacaaagat
gatcgggaaggcagatttgttcttaagaatgagaatgacgccattcctcctaagaaggct
caaagtaatggacctgaaaagcaggaaaaagaaggggttatccagaacttcaagagaact
ctctcaaagaaagaaaagaaggaaaaaaagaagagagaaaaagaggcattgcgacaggca
tctgataaagatgatagacctttccaaggggaggatgttgaaaattctcgactggctgct
gaggtttacaaagacatgccggaaaccagctttactcgaaccatttctaatcctgaggtg
gttatgaaacgacggaggcagcaaaaattggaaaagagaatgcaggaatttcggagctca
gatgggcggcctgattcaggtggaacattgagaatttatgcagatagtttaaaaccaaat
attccctacaagacaatcctgctgtctactacagatcctgcagactttgctgtggctgaa
gctttagagaagtatggtctggaaaaagaaaaccctaaggattactgcatcgcccgggtt
atgcttcctcctggagcccagcattctgatgaaaagggtgctaaagaaattattcttgat
gatgatgagtgtcctttacaaatcttcagggaatggccaagtgacaaagggattttagtc
tttcagttgaagaggaggccaccagaccacatcccaaagaaaaccaagaaacacttggaa
ggcaagacacccaagggaaaggagagagctgacgggtctggctatggctccacccttcct
ccggagaagctgccctatttagtagagttaagcccagggagaaggaatcactttgcctac
tacaactatcacacttacgaagatggttctgactctagagataagccaaagctttaccgc
cttcagttaagtgttactgaagttgggacagaaaagttggatgacaactctatccagttg
tttggcccaggaattcagccccatcactgtgaccttaccaacatggatggagtggtcact
gtgacgcccagaagtatggacgcagaaacctacgtggaaggccagcgcatctcagaaacc
accatgctgcagagtggcatgaaagtgcagtttggggcgtcccatgtatttaagtttgtg
gaccccagtcaggatcatgctcttgcaaaaagatctgtggatggaggcctgatggttaag
ggcccaagacataaacctggaattgttcaggagacaacttttgatttgggaggagatatt
catagtgggacagcattaccgacaagcaagagcaccactaggctggacagcgacagagtg
tcgtctgcctctagcacagccgagcggggaatggtgaagccgatgatcagagtagaacag
cagccagattatcgcaggcaagaaagcagaacacaggatgcttctgggcctgagctgata
ctacctgcaagcattgaattcagggaaagttctgaagattcatttttgtctgccattata
aattatactaatagctctacagtccactttaagttgtcccctacatatgtattatatatg
gcatgccggtatgtattgtccaaccagtacagacctgacatcagccctacagagcgcaca
cataaagtcattgcagtcgtcaacaagatggtgagcatgatggagggtgtcatccagaaa
cagaagaatattgcaggggcacttgccttctggatggcaaatgcatctgaacttctcaac
ttcattaagcaagaccgagaccttagtcggatcacactggatgctcaagatgttttagca
catttggttcaaatggcatttaaatacttggttcactgtcttcaatcagaacttaataat
tacatgccagcctttctagatgaccctgaagagaacagtctgcaacgaccaaaaatagat
gatgtgctgcacacgctcacaggagccatgtccttgctacgacgctgcagagtcaatgcc
gccctgaccatccagctcttctctcagctcttccacttcatcaatatgtggctgttcaat
agattggtgaccgacccagattcggggctgtgctcccattactggggtgcgattatccgt
cagcagttgggccatattgaagcctgggctgagaagcaggggctggaactggctgcggac
tgtcatctgagcaggatcgtgcaggcaacgactttgcttaccatggataagtatgcacct
gatgacattccaaatataaacagcacctgctttaagttaaattcattacaacttcaagcc
ttattacagaactatcactgtgcacctgatgagccttttatcccaacggatcttatagaa
aatgtagtgactgtggctgaaaacactgccgatgagctggcccgcagtgatggaagggaa
gtgcagttggaggaggatcctgatctgcagctgccgtttcttttgccagaagatggttat
tcttgtgatgttgtcagaaacattccaaatggtttacaagaatttttagaccctctgtgc
cagagaggattttgcaggttaattcctcacacacgttcaccaggtacttggacaatatat
tttgaaggtgcagattatgaaagtcaccttctgcgtgagaacacagagctggctcagcct
ctgaggaaagaacctgaaataatcactgtgaccctaaaaaagcagaatggaatgggcctt
agcattgttgcagcaaagggtgctggtcaagataaactaggaatctatgtgaagtcggtt
gtgaaaggaggtgctgcagatgtggatggacgtctagctgcaggtgatcagctcctcagt
gtggatggacgaagtctggttggactctctcaggaaagggcggcagaactcatgacaaga
acaagctctgtggtgacactggaagtagcaaagcagggtgccatctaccacggtctggcc
acccttctcaatcagccatcccccatgatgcagagaatttcagatcgtcgtggctcaggt
aaaccccgaccaaagagtgaaggctttgagctctataataattcaactcaaaatgggtct
cctgagagtcctcagctgccttgggcagaatatagtgaaccaaagaaattgcctggtgat
gacagactgatgaaaaatagagctgatcaccgttccagccccaacgtagcaaatcagcct
cctagtcctggagggaaaagtgcatatgcctctggaacaacagcgaagataacatctgtc
tctactggaaacctctgcactgaggagcagacgcctccgcctagacctgaagcctacccc
atccccactcagacgtacaccagagagtattttaccttcccagcttccaaatcccaggat
cggatggctcctcctcagaaccagtggccaaattatgaggaaaagccacatatgcacaca
gatagtaatcattccagtattgcaattcagcgtgttacacgttcccaagaagaacttcga
gaagataaagcttaccaacttgagcggcatcgaatagaggcagctatggaccgaaagtct
gatagtgatatgtggataaatcagagctcctcactggactccagtacctctagccaggag
catctgaaccattcctctaagtcggtcacccctgcttccacactgaccaaaagtggccct
ggccgttggaaaacaccagcagccataccggccacccctgtggccgtctcccagccaatc
cgaacagacctgcctccgccacccccgccacctccagtccactatgccggtgatttcgat
ggaatgtccatggatttgcctctcccaccacccccttccgccaaccagatagggctgccg
tctgcgcaggtggctgctgctgaacggagaaagagagaagaacatcagcgttggtatgag
aaggagaaggcccgcctggaggaggagcgggagaggaagcggagagagcaggagaggaag
ttgggccagatgcgcactcagtccttaaaccctgctccgttttctcccctgactgcacag
cagatgaagcccgaaaagccttccacactccagcggccacaggaaacagtcattcgggag
ctgcagcctcagcagcagccccgcacgatcgagcgcagagacttgcagtacattacagtc
agcaaagaggagctttcctcgggggacagtctgtcccccgacccgtggaagcgggacgcc
aaggagaagctggagaagcagcagcagatgcacatcgtggacatgctgagcaaggagatc
caggagctccagagcaaaccggaccgcagcgccgaggagagcgaccggctgcgcaagctc
atgctggagtggcagttccagaagagactccaggagtcgaagcagaaggacgaagatgac
gaggaggaggaggacgatgatgtggacaccatgctgatcatgcagcgcctggaggctgaa
cgaagagcgagggacgaggagcggaggcggcagcagcagttagaagagatgcgcaagcgg
gaagcggaagaccgagcgaggcaagaggaagagcgccggcggcaggaggaggagcgaaca
aaacgagacgctgaagaaaaggttatggtcctttaa

DBGET integrated database retrieval system