KEGG   Homo sapiens (human): 4308Help
Entry
4308              CDS       T01001                                 

Gene name
TRPM1, CSNB1C, LTRPC1, MLSN1
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 1
  KO
K04976  
transient receptor potential cation channel subfamily M member 1
Organism
hsa  Homo sapiens (human)
Disease
H00787  
Congenital stationary night blindness (CSNB)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   4308 (TRPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q13.3
AA seq 1603 aa AA seqDB search
MKDSNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLE
FQGGGYSNKAMYIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVF
GKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSSKSRGRVCAIGIAPWGIVENKEDL
VGKDVTRVYQTMSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRLLEKHISLQKIN
TRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHKYCEEGG
IINESLREQLLVTIQKTFNYNKAQSHQLFAIIMECMKKKELVTVFRMGSEGQQDIEMAIL
TALLKGTNVSAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPP
MATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLL
IENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYL
MGGAYRCNYTRKNFRTLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDV
DDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESD
LVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKH
RDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKEN
EDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLG
YLLLFNYVILVRMDGWPSLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWN
ITDLVAISTFMIGAILRLQNQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIG
KMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQID
LYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFF
EVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERD
RGLKLFLSDEELKRLHEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEIN
ERETFMKTSLQTVDLRLAQLEELSNRMVNALENLAGIDRSDLIQARSRASSECEATYLLR
QSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPEC
QNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDDERQTDSKKEETISPS
LNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSF
VYSRGRKLVGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKE
QFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNV
KSIQGKLDRSGHASSVSSLVIVSGMTAEEKKVKKEKASTETEC
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactctaacaggtgttgctgtggccagttcaccaaccagcatatcccccctctg
ccaagtgcaacacccagcaaaaatgaagaggaaagcaaacaggtggagactcagcctgag
aaatggtctgttgccaagcacacccagagctacccaacagattcctatggagttcttgaa
ttccagggtggcggatattccaataaagccatgtatatccgtgtatcctatgacaccaag
ccagactcactgctccatctcatggtgaaagattggcagctggaactccccaagctctta
atatctgtgcatggaggcctccagaactttgagatgcagcccaagctgaaacaagtcttt
gggaaaggcctgatcaaggctgctatgaccaccggggcctggatcttcaccgggggtgtc
agcacaggtgttatcagccacgtaggggatgccttgaaagaccactcctccaagtccaga
ggccgggtttgtgctataggaattgctccatggggcatcgtggagaataaggaagacctg
gttggaaaggatgtaacaagagtgtaccagaccatgtccaaccctctaagtaagctctct
gtgctcaacaactcccacacccacttcatcctggctgacaatggcaccctgggcaagtat
ggcgccgaggtgaagctgcgaaggctgctggaaaagcacatctccctgcagaagatcaac
acaagactggggcagggcgtgcccctcgtgggtctcgtggtggaggggggccctaacgtg
gtgtccatcgtcttggaatacctgcaagaagagcctcccatccctgtggtgatttgtgat
ggcagcggacgtgcctcggacatcctgtcctttgcgcacaagtactgtgaagaaggcgga
ataataaatgagtccctcagggagcagcttctagttaccattcagaaaacatttaattat
aataaggcacaatcacatcagctgtttgcaattataatggagtgcatgaagaagaaagaa
ctcgtcactgtgttcagaatgggttctgagggccagcaggacatcgagatggcaatttta
actgccctgctgaaaggaacaaacgtatctgctccagatcagctgagcttggcactggct
tggaaccgcgtggacatagcacgaagccagatctttgtctttgggccccactggccgccc
ctgggaagcctggcacccccgacggacagcaaagccacggagaaggagaagaagccaccc
atggccaccaccaagggaggaagaggaaaagggaaaggcaagaagaaagggaaagtgaaa
gaggaagtggaggaagaaactgacccccggaagatagagctgctgaactgggtgaatgct
ttggagcaagcgatgctagatgctttagtcttagatcgtgtcgactttgtgaagctcctg
attgaaaacggagtgaacatgcaacactttctgaccattccgaggctggaggagctttat
aacacaagactgggtccaccaaacacacttcatctgctggtgagggatgtgaaaaagagc
aaccttccgcctgattaccacatcagcctcatagacatcgggctcgtgctggagtacctc
atgggaggagcctaccgctgcaactacactcggaaaaactttcggaccctttacaacaac
ttgtttggaccaaagaggcctaaagctcttaaacttctgggaatggaagatgatgagcct
ccagctaaagggaagaaaaagaaaaagaagaaaaaggaggaagagatcgacattgatgtg
gacgaccctgccgtgagtcggttccagtatcccttccacgagctgatggtgtgggcagtg
ctgatgaaacgccagaaaatggcagtgttcctctggcagcgaggggaagagagcatggcc
aaggccctggtggcctgcaagctctacaaggccatggcccacgagtcctccgagagtgat
ctggtggatgacatctcccaggacttggataacaattccaaagacttcggccagcttgct
ttggagttattagaccagtcctataagcatgacgagcagatcgctatgaaactcctgacc
tacgagctgaaaaactggagcaactcgacctgcctcaaactggccgtggcagccaaacac
cgggacttcattgctcacacctgcagccagatgctgctgaccgatatgtggatgggaaga
ctgcggatgcggaagaaccccggcctgaaggttatcatggggattcttctaccccccacc
atcttgtttttggaatttcgcacatatgatgatttctcgtatcaaacatccaaggaaaat
gaggatggcaaagaaaaagaagaggaaaatacggatgcaaatgcagatgctggctcaaga
aagggggatgaggagaacgagcacaaaaaacagagaagtattcccatcggaacaaagatc
tgtgaattctataacgcgcccattgtcaagttctggttttacacaatatcatacttgggc
tacctgctgctgtttaactacgtcatcctggtgcggatggatggctggccgtccctccag
gagtggatcgtcatctcctacatcgtgagcctggcgttagagaagatacgagagatcctc
atgtcagaaccaggcaaactcagccagaaaatcaaagtttggcttcaggagtactggaac
atcacagatctcgtggccatttccacattcatgattggagcaattcttcgcctacagaac
cagccctacatgggctatggccgggtgatctactgtgtggatatcatcttctggtacatc
cgtgtcctggacatctttggtgtcaacaagtatctggggccatacgtgatgatgattgga
aagatgatgatcgacatgctgtactttgtggtcatcatgctggtcgtgctcatgagtttc
ggagtagcccgtcaagccattctgcatccagaggagaagccctcttggaaactggcccga
aacatcttctacatgccctactggatgatctatggagaggtgtttgcagaccagatagac
ctctacgccatggaaattaatcctccttgtggtgagaacctatatgatgaggagggcaag
cggcttcctccctgtatccccggcgcctggctcactccagcactcatggcgtgctatcta
ctggtcgccaacatcctgctggtgaacctgctgattgctgtgttcaacaataccttcttt
gaagtaaaatcaatatccaaccaggtgtggaagttccagcgatatcagctgattatgaca
tttcatgacaggccagtcctgcccccaccgatgatcattttaagccacatctacatcatc
attatgcgtctcagcggccgctgcaggaaaaagagagaaggggaccaagaggaacgggat
cgtggattgaagctcttccttagcgacgaggagctaaagaggctgcatgagttcgaggag
cagtgcgtgcaggagcacttccgggagaaggaggatgagcagcagtcgtccagcgacgag
cgcatccgggtcacttctgaaagagttgaaaatatgtcaatgaggttggaagaaatcaat
gaaagagaaacttttatgaaaacttccctgcagactgttgaccttcgacttgctcagcta
gaagaattatctaacagaatggtgaatgctcttgaaaatcttgcgggaatcgacaggtct
gacctgatccaggcacggtcccgggcttcttctgaatgtgaggcaacgtatcttctccgg
caaagcagcatcaatagcgctgatggctacagcttgtatcgatatcattttaacggagaa
gagttattatttgaggatacatctctctccacgtcaccagggacaggagtcaggaaaaaa
acctgttccttccgtataaaggaagagaaggacgtgaaaacgcacctagtcccagaatgt
cagaacagtcttcacctttcactgggcacaagcacatcagcaaccccagatggcagtcac
cttgcagtagatgacttaaagaacgctgaagagtcaaaattaggtccagatattgggatt
tcaaaggaagatgatgaaagacagacagactctaaaaaagaagaaactatttccccaagt
ttaaataaaacagatgtgatacatggacaggacaaatcagatgttcaaaacactcagcta
acagtggaaacgacaaatatagaaggcactatttcctatcccctggaagaaaccaaaatt
acacgctatttccccgatgaaacgatcaatgcttgtaaaacaatgaagtccagaagcttc
gtctattcccggggaagaaagctggtcggtggggttaaccaggatgtagagtacagttca
atcacggaccagcaattgacgacggaatggcaatgccaagttcaaaagatcacgcgctct
catagcacagatattccttacattgtgtcggaagctgcagtgcaagctgagcataaagag
cagtttgcagatatgcaagatgaacaccatgtcgctgaagcaattcctcgaatccctcgc
ttgtccctaaccattactgacagaaatgggatggaaaacttactgtctgtgaagccagat
caaactttgggattcccatctctcaggtcaaaaagtttacatggacatcctaggaatgtg
aaatccattcagggaaagttagacagatctggacatgccagtagtgtaagcagcttagta
attgtgtctggaatgacagcagaagaaaaaaaggttaagaaagagaaagcttccacagaa
actgaatgctag

DBGET integrated database retrieval system