KEGG   Homo sapiens (human): 4314Help
Entry
4314              CDS       T01001                                 

Gene name
MMP3, CHDS6, MMP-3, SL-1, STMY, STMY1, STR1
Definition
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05323  Rheumatoid arthritis
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
Disease
H01742  Coronary artery disease
Drug target
Marimastat: D03795
Prinomastat: D03797
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    4314 (MMP3)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    4314 (MMP3)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4314 (MMP3)
   05215 Prostate cancer
    4314 (MMP3)
  Immune diseases
   05323 Rheumatoid arthritis
    4314 (MMP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     4314 (MMP3)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4314 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Reprolysin_3 Reprolysin_5 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 4314
NCBI-ProteinID: NP_002413
OMIM: 185250
HGNC: 7173
Ensembl: ENSG00000149968
Vega: OTTHUMG00000048254
Pharos: P08254(Tchem)
UniProt: P08254
Structure
PDB: 

Jmol
Position
11q22.2
AA seq 477 aa AA seqDB search
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcttccaatcctactgttgctgtgcgtggcagtttgctcagcctatccattg
gatggagctgcaaggggtgaggacaccagcatgaaccttgttcagaaatatctagaaaac
tactacgacctcaaaaaagatgtgaaacagtttgttaggagaaaggacagtggtcctgtt
gttaaaaaaatccgagaaatgcagaagttccttggattggaggtgacggggaagctggac
tccgacactctggaggtgatgcgcaagcccaggtgtggagttcctgatgttggtcacttc
agaacctttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat
tatacaccagatttgccaaaagatgctgttgattctgctgttgagaaagctctgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctcttttgcagttagagaacatggagacttttacccttttgatggacctggaaatgtt
ttggcccatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat
gaacaatggacaaaggatacaacagggaccaatttatttctcgttgctgctcatgaaatt
ggccactccctgggtctctttcactcagccaacactgaagctttgatgtacccactctat
cactcactcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag
tccctctatggacctccccctgactcccctgagacccccctggtacccacggaacctgtc
cctccagaacctgggacgccagccaactgtgatcctgctttgtcctttgatgctgtcagc
actctgaggggagaaatcctgatctttaaagacaggcacttttggcgcaaatccctcagg
aagcttgaacctgaattgcatttgatctcttcattttggccatctcttccttcaggcgtg
gatgccgcatatgaagttactagcaaggacctcgttttcatttttaaaggaaatcaattc
tgggctatcagaggaaatgaggtacgagctggatacccaagaggcatccacaccctaggt
ttccctccaaccgtgaggaaaatcgatgcagccatttctgataaggaaaagaacaaaaca
tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca
ggctttcccaagcaaatagctgaagactttccagggattgactcaaagattgatgctgtt
tttgaagaatttgggttcttttatttctttactggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacactttgaagagtaacagctggcttaattgttga

DBGET integrated database retrieval system