KEGG   Homo sapiens (human): 4320Help
Entry
4320              CDS       T01001                                 

Gene name
MMP11, SL-3, ST3, STMY3
Definition
(RefSeq) matrix metallopeptidase 11
  KO
K07993  
matrix metalloproteinase-11 (stromelysin 3) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     4320 (MMP11)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4320 (MMP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.23
AA seq 488 aa AA seqDB search
MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPA
PAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQ
LVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHA
FFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFR
YPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGA
QYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDS
PVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGC
AEPANTFL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctccggccgcctggctccgcagcgcggccgcgcgcgccctcctgcccccgatgctg
ctgctgctgctccagccgccgccgctgctggcccgggctctgccgccggacgcccaccac
ctccatgccgagaggagggggccacagccctggcatgcagccctgcccagtagcccggca
cctgcccctgccacgcaggaagccccccggcctgccagcagcctcaggcctccccgctgt
ggcgtgcccgacccatctgatgggctgagtgcccgcaaccgacagaagaggttcgtgctt
tctggcgggcgctgggagaagacggacctcacctacaggatccttcggttcccatggcag
ttggtgcaggagcaggtgcggcagacgatggcagaggccctaaaggtatggagcgatgtg
acgccactcacctttactgaggtgcacgagggccgtgctgacatcatgatcgacttcgcc
aggtactggcatggggacgacctgccgtttgatgggcctgggggcatcctggcccatgcc
ttcttccccaagactcaccgagaaggggatgtccacttcgactatgatgagacctggact
atcggggatgaccagggcacagacctgctgcaggtggcagcccatgaatttggccacgtg
ctggggctgcagcacacaacagcagccaaggccctgatgtccgccttctacacctttcgc
tacccactgagtctcagcccagatgactgcaggggcgttcaacacctatatggccagccc
tggcccactgtcacctccaggaccccagccctgggcccccaggctgggatagacaccaat
gagattgcaccgctggagccagacgccccgccagatgcctgtgaggcctcctttgacgcg
gtctccaccatccgaggcgagctctttttcttcaaagcgggctttgtgtggcgcctccgt
gggggccagctgcagcccggctacccagcattggcctctcgccactggcagggactgccc
agccctgtggacgctgccttcgaggatgcccagggccacatttggttcttccaaggtgct
cagtactgggtgtacgacggtgaaaagccagtcctgggccccgcacccctcaccgagctg
ggcctggtgaggttcccggtccatgctgccttggtctggggtcccgagaagaacaagatc
tacttcttccgaggcagggactactggcgtttccaccccagcacccggcgtgtagacagt
cccgtgccccgcagggccactgactggagaggggtgccctctgagatcgacgctgccttc
caggatgctgatggctatgcctacttcctgcgcggccgcctctactggaagtttgaccct
gtgaaggtgaaggctctggaaggcttcccccgtctcgtgggtcctgacttctttggctgt
gccgagcctgccaacactttcctctga

DBGET integrated database retrieval system