KEGG   Homo sapiens (human): 4322Help
Entry
4322              CDS       T01001                                 

Gene name
MMP13, CLG3, MANDP1, MMP-13
Definition
(RefSeq) matrix metallopeptidase 13 (EC:3.4.24.-)
  KO
K07994  
matrix metalloproteinase-13 (collagenase 3) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00479  
Metaphyseal dysplasias
Drug target
Other: 
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     4322 (MMP13)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4322 (MMP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 471 aa AA seqDB search
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaggggtcctggctgccttcctcttcttgagctggactcattgtcgggccctg
ccccttcccagtggtggtgatgaagatgatttgtctgaggaagacctccagtttgcagag
cgctacctgagatcatactaccatcctacaaatctcgcgggaatcctgaaggagaatgca
gcaagctccatgactgagaggctccgagaaatgcagtctttcttcggcttagaggtgact
ggcaaacttgacgataacaccttagatgtcatgaaaaagccaagatgcggggttcctgat
gtgggtgaatacaatgttttccctcgaactcttaaatggtccaaaatgaatttaacctac
agaattgtgaattacacccctgatatgactcattctgaagtcgaaaaggcattcaaaaaa
gccttcaaagtttggtccgatgtaactcctctgaattttaccagacttcacgatggcatt
gctgacatcatgatctcttttggaattaaggagcatggcgacttctacccatttgatggg
ccctctggcctgctggctcatgcttttcctcctgggccaaattatggaggagatgcccat
tttgatgatgatgaaacctggacaagtagttccaaaggctacaacttgtttcttgttgct
gcgcatgagttcggccactccttaggtcttgaccactccaaggaccctggagcactcatg
tttcctatctacacctacaccggcaaaagccactttatgcttcctgatgacgatgtacaa
gggatccagtctctctatggtccaggagatgaagaccccaaccctaaacatccaaaaacg
ccagacaaatgtgacccttccttatcccttgatgccattaccagtctccgaggagaaaca
atgatctttaaagacagattcttctggcgcctgcatcctcagcaggttgatgcggagctg
tttttaacgaaatcattttggccagaacttcccaaccgtattgatgctgcatatgagcac
ccttctcatgacctcatcttcatcttcagaggtagaaaattttgggctcttaatggttat
gacattctggaaggttatcccaaaaaaatatctgaactgggtcttccaaaagaagttaag
aagataagtgcagctgttcactttgaggatacaggcaagactctcctgttctcaggaaac
caggtctggagatatgatgatactaaccatattatggataaagactatccgagactaata
gaagaagacttcccaggaattggtgataaagtagatgctgtctatgagaaaaatggttat
atctattttttcaacggacccatacagtttgaatacagcatctggagtaaccgtattgtt
cgcgtcatgccagcaaattccattttgtggtgttaa

DBGET integrated database retrieval system