KEGG   Homo sapiens (human): 4323Help
Entry
4323              CDS       T01001                                 

Gene name
MMP14, MMP-14, MMP-X1, MT-MMP, MT-MMP_1, MT1-MMP, MT1MMP, MTMMP1, WNCHRS
Definition
matrix metallopeptidase 14 (membrane-inserted) (EC:3.4.24.80)
Orthology
K07763  
matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
hsa  Homo sapiens (human)
Pathway
TNF signaling pathway
GnRH signaling pathway
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    4323 (MMP14)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    4323 (MMP14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     4323 (MMP14)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4323 (MMP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 582 aa AA seqDB search
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgccccaagacccccccgttgtctcctgctccccctgctcacgctcggcacc
gcgctcgcctccctcggctcggcccaaagcagcagcttcagccccgaagcctggctacag
caatatggctacctgcctcccggggacctacgtacccacacacagcgctcaccccagtca
ctctcagcggccatcgctgccatgcagaagttttacggcttgcaagtaacaggcaaagct
gatgcagacaccatgaaggccatgaggcgcccccgatgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctacgccatccagggtctcaaatggcaa
cataatgaaatcactttctgcatccagaattacacccccaaggtgggcgagtatgccaca
tacgaggccattcgcaaggcgttccgcgtgtgggagagtgccacaccactgcgcttccgc
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagcacgcccttcgatggtgagggcggcttcctggcc
catgcctacttcccaggccccaacattggaggagacacccactttgactctgccgagcct
tggactgtcaggaatgaggatctgaatggaaatgacatcttcctggtggctgtgcacgag
ctgggccatgccctggggctcgagcattccagtgacccctcggccatcatggcacccttt
taccagtggatggacacggagaattttgtgctgcccgatgatgaccgccggggcatccag
caactttatgggggtgagtcagggttccccaccaagatgccccctcaacccaggactacc
tcccggccttctgttcctgataaacccaaaaaccccacctatgggcccaacatctgtgac
gggaactttgacaccgtggccatgctccgaggggagatgtttgtcttcaaggagcgctgg
ttctggcgggtgaggaataaccaagtgatggatggatacccaatgcccattggccagttc
tggcggggcctgcctgcgtccatcaacactgcctacgagaggaaggatggcaaattcgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcgtccctggaacctggctacccc
aagcacattaaggagctgggccgagggctgcctaccgacaagattgatgctgctctcttc
tggatgcccaatggaaagacctacttcttccgtggaaacaagtactaccgtttcaacgaa
gagctcagggcagtggatagcgagtaccccaagaacatcaaagtctgggaagggatccct
gagtctcccagagggtcattcatgggcagcgatgaagtcttcacttacttctacaagggg
aacaaatactggaaattcaacaaccagaagctgaaggtagaaccgggctaccccaagtca
gccctgagggactggatgggctgcccatcgggaggccggccggatgaggggactgaggag
gagacggaggtgatcatcattgaggtggacgaggagggcggcggggcggtgagcgcggct
gccgtggtgctgcccgtgctgctgctgctcctggtgctggcggtgggccttgcagtcttc
ttcttcagacgccatgggacccccaggcgactgctctactgccagcgttccctgctggac
aaggtctga

DBGET integrated database retrieval system