KEGG   Homo sapiens (human): 4329Help
Entry
4329              CDS       T01001                                 

Gene name
ALDH6A1, MMSADHA, MMSDH
Definition
(RefSeq) aldehyde dehydrogenase 6 family member A1 (EC:1.2.1.27 1.2.1.18)
  KO
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4329 (ALDH6A1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    4329 (ALDH6A1)
   00562 Inositol phosphate metabolism
    4329 (ALDH6A1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4329 (ALDH6A1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4329 (ALDH6A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     4329 (ALDH6A1)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     4329 (ALDH6A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 535 aa AA seqDB search
MAALLAAAAVRARILQVSSKVKSSPTWYSASSFSSSVPTVKLFIGGKFVESKSDKWIDIH
NPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIA
KLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCA
GIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHG
QHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKEN
TLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLIT
PQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFG
PVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLP
MFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctattggcggcggcggcagtgcgagcccggatcctgcaggtttcttccaag
gtgaaatccagtcccacctggtattcagcatcttccttctcttcttcagtgccaactgta
aagctcttcattggtgggaaattcgttgaatccaaaagtgacaaatggatcgatatccac
aacccagccaccaatgaggtcattggtcgggtccctcaggccaccaaggcagaaatggat
gcagccattgcttcctgcaaacgtgcttttcctgcatgggcagacacttcagtattaagc
cgccagcaggtcttgctccgctatcaacaacttattaaagaaaacttgaaagaaattgcc
aagttaatcacattggaacaagggaagaccctagctgatgctgaaggagatgtatttcga
ggccttcaggtggttgagcatgcctgtagtgtgacatccctcatgatgggagagaccatg
ccatccatcaccaaagacatggacctttattcctaccgtctgcctctgggagtgtgtgca
ggcattgctccattcaattttcctgccatgatccccctttggatgtttcccatggccatg
gtgtgtggaaataccttcctaatgaaaccatctgagcgagtccctggagcaactatgctt
cttgctaagttgctccaggattctggtgcccctgatggaacattaaacatcatccatgga
cagcatgaagctgtaaattttatttgcgatcatccggacatcaaagcaatcagctttgtg
ggatccaacaaggcaggagagtatatcttcgagagaggatcaagacatggcaagagggtt
caagccaatatgggagccaagaaccatggggtagtcatgccagatgccaataaggaaaat
accctgaaccagctggttggggcagcatttggagctgctggtcagcgctgcatggctctt
tcaacagcagtccttgtgggagaagccaagaagtggctgccagagctggtggagcatgcc
aaaaacctgagagtcaatgcaggagatcagcctggagctgatcttggccctctgatcact
ccccaggccaaagagcgagtctgtaatctgattgatagtggaacaaaggagggagcttcc
atccttcttgatggacgaaaaattaaagtgaaaggctatgaaaatggcaactttgttgga
ccaaccatcatctcgaatgtcaagccaaatatgacctgttacaaagaggagatttttggt
ccagttcttgtggttctggagacagaaacattggatgaagccatccagattgtaaataac
aacccatatggaaatggaactgccatcttcaccaccaatggagccactgctcggaaatat
gcccacttggtggatgttggacaggtgggagtgaatgtccccattccagtgcctttgcca
atgttctcattcaccggctctcgatcctccttcaggggagacaccaatttctatggcaaa
cagggcatccaattctacactcagttaaagaccattacttctcagtggaaagaagaagat
gctactctttcctcacctgctgttgtcatgcctaccatgggccgttag

DBGET integrated database retrieval system