KEGG   Homo sapiens (human): 4338Help
Entry
4338              CDS       T01001                                 

Gene name
MOCS2, MCBPE, MOCO1, MOCODB, MPTS
Definition
molybdenum cofactor synthesis 2 (EC:2.8.1.12)
Orthology
K03635  
molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Disease
H00192  
Xanthinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4338 (MOCS2)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    4338 (MOCS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     4338 (MOCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11
AA seq 188 aa AA seqDB search
MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNK
ECFWASNS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcttggagatcagctcctcgtgcttcagcctggagacgaaattgccgttatcc
cccccattagtggaggatagtgcttttgagccatctaggaaagatatggatgaagttgaa
gagaaatctaaagatgttataaactttactgccgagaaactttcagtagatgaagtctca
cagttggtgatttctccgctctgtggtgcaatatccctatttgtagggactacaagaaat
aactttgaagggaaaaaagtcattagcttagaatatgaagcatatctacccatggcggaa
aatgaagtcagaaagatttgtagtgacattaggcagaaatggccagtcaaacacatagca
gtgttccatagacttggcttggttccagtgtcagaagcaagcataatcattgctgtgtcc
tcagcccacagagctgcatctcttgaagctgtgagctatgccattgatactttaaaagcc
aaggtgcccatatggaaaaaggaaatatacgaagagtcatcaacttggaaaggaaacaaa
gagtgcttttgggcatccaacagttaa

DBGET integrated database retrieval system