KEGG   Homo sapiens (human): 4338Help
Entry
4338              CDS       T01001                                 

Gene name
MOCS2, MCBPE, MOCO1, MOCODB, MPTS
Definition
molybdenum cofactor synthesis 2 (EC:2.8.1.12)
Orthology
K03635  
molybdopterin synthase catalytic subunit [EC:2.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Disease
H00192  
Xanthinuria
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hsa00790]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:hsa04122]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11
AA seq 188 aa AA seqDB search
MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNK
ECFWASNS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcttggagatcagctcctcgtgcttcagcctggagacgaaattgccgttatcc
cccccattagtggaggatagtgcttttgagccatctaggaaagatatggatgaagttgaa
gagaaatctaaagatgttataaactttactgccgagaaactttcagtagatgaagtctca
cagttggtgatttctccgctctgtggtgcaatatccctatttgtagggactacaagaaat
aactttgaagggaaaaaagtcattagcttagaatatgaagcatatctacccatggcggaa
aatgaagtcagaaagatttgtagtgacattaggcagaaatggccagtcaaacacatagca
gtgttccatagacttggcttggttccagtgtcagaagcaagcataatcattgctgtgtcc
tcagcccacagagctgcatctcttgaagctgtgagctatgccattgatactttaaaagcc
aaggtgcccatatggaaaaaggaaatatacgaagagtcatcaacttggaaaggaaacaaa
gagtgcttttgggcatccaacagttaa

DBGET integrated database retrieval system