KEGG   Homo sapiens (human): 4342Help
Entry
4342              CDS       T01001                                 

Gene name
MOS, MSV
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagttttccccatcggtggac
gcgcggccctgcagcagtccctcagagctacctgcgaagctgcttctgggggccactctt
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttgctgcagaggctgggagctggagggtttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcagggtccaatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgccgcactggaggacagttaagtttgggaaagtgtctcaag
tactcactagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaggatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgctgtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcggtggtggcctacgacctgcgcccgtccctctcc
gctgccgtcttcgaggactcgctccccgggcagcgccttggggacgtcatccagcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaactcggctga

DBGET integrated database retrieval system