KEGG   Homo sapiens (human): 4342Help
Entry
4342              CDS       T01001                                 

Gene name
MOS, MSV
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4342 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4342 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    4342 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    4342 (MOS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4342 (MOS)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  MOS family
   4342 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagttttccccatcggtggac
gcgcggccctgcagcagtccctcagagctacctgcgaagctgcttctgggggccactctt
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttgctgcagaggctgggagctggagggtttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcagggtccaatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgccgcactggaggacagttaagtttgggaaagtgtctcaag
tactcactagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaggatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgctgtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcggtggtggcctacgacctgcgcccgtccctctcc
gctgccgtcttcgaggactcgctccccgggcagcgccttggggacgtcatccagcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaactcggctga

DBGET integrated database retrieval system