KEGG   Homo sapiens (human): 4350Help
Entry
4350              CDS       T01001                                 

Gene name
MPG, AAG, ADPG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg
Definition
(RefSeq) N-methylpurine DNA glycosylase
  KO
K03652  
DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    4350 (MPG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     4350 (MPG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4350 (MPG)
 Prokaryotic Type
     4350 (MPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P29372(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 298 aa AA seqDB search
MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRER
CLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGR
IVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVL
LRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDE
AVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccccgctttgcagatgaagaaaccaaagcagttttgccgacggatggggcaa
aagaagcagcgaccagctagagcagggcagccacacagctcgtccgacgcagcccaggca
cctgcagagcagccacacagctcgtccgatgcagcccaggcaccttgccccagggagcgc
tgcttgggaccgcccaccactccgggcccataccgcagcatctatttctcaagcccaaag
ggccaccttacccgactggggttggagttcttcgaccagccggcagtccccctggcccgg
gcatttctgggacaggtcctagtccggcgacttcctaatggcacagaactccgaggccgc
atcgtggagaccgaggcatacctggggccagaggatgaagccgcccactcaaggggtggc
cggcagaccccccgcaaccgaggcatgttcatgaagccggggaccctgtacgtgtacatc
atttacggcatgtacttctgcatgaacatctccagccagggggacggggcttgcgtcttg
ctgcgagcactggagcccctggaaggtctggagaccatgcgtcagcttcgcagcaccctc
cggaaaggcaccgccagccgtgtcctcaaggaccgcgagctctgcagtggcccctccaag
ctgtgccaggccctggccatcaacaagagctttgaccagagggacctggcacaggatgaa
gctgtatggctggagcgtggtcccctggagcccagtgagccggctgtagtggcagcagcc
cgggtgggcgtcggccatgcaggggagtgggcccggaaacccctccgcttctatgtccgg
ggcagcccctgggtcagtgtggtcgacagagtggctgagcaggacacacaggcctga

DBGET integrated database retrieval system