KEGG   Homo sapiens (human): 4351Help
Entry
4351              CDS       T01001                                 

Gene name
MPI, CDG1B, PMI, PMI1
Definition
(RefSeq) mannose phosphate isomerase
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Disease
H00118  Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4351 (MPI)
   00520 Amino sugar and nucleotide sugar metabolism
    4351 (MPI)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     4351 (MPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMI_typeI
Motif
Other DBs
NCBI-GeneID: 4351
NCBI-ProteinID: NP_002426
OMIM: 154550
HGNC: 7216
Ensembl: ENSG00000178802
Vega: OTTHUMG00000142826
Pharos: P34949(Tchem)
UniProt: P34949
Position
15q24.1
AA seq 423 aa AA seqDB search
MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAK
ILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEK
LHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLK
QTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQ
LHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTP
KFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYK
VLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC
CLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccgctccgcgagtattcccactttcctgtgcggtgcagcagtatgcctgggggaag
atgggttccaacagcgaagtggcgcggctgttggccagcagtgatccactggcccagatc
gcagaggacaagccttatgcagagttgtggatggggactcacccccgaggggatgccaag
atccttgacaaccgcatctcacagaagaccctaagccagtggattgctgagaaccaggac
agcttgggctcaaaggtcaaggacacctttaatggcaacctgcccttcctcttcaaagtg
ctctcagttgaaacacccctgtccatccaggcacaccctaacaaggagctggcagagaag
ctgcacctccaggctccgcagcactaccccgatgccaaccacaagccagagatggccatt
gccctcacccccttccagggcttgtgtggcttccggccagttgaggagattgtaaccttt
ctaaagaaggtgcctgagtttcagttcctgattggagatgaggcagcaacacacctgaag
cagaccatgagccatgactcccaggctgtggcctcctctctgcagagctgtttctcccac
ctgatgaagagtgagaagaaggtggtggtggaacagctcaacctgttggtgaagcggatc
tcccagcaagcggctgccggaaacaacatggaggacatctttggggagcttttgctacag
ctgcaccagcagtacccaggtgatatcggctgctttgccatctacttcctgaacctgctt
accctgaagcctggggaggccatgtttctggaggccaacgtaccccatgcctacctgaaa
ggagactgcgtggagtgcatggcgtgttcagacaacacagttcgtgctggcctgacaccc
aagttcattgatgtgccaaccctgtgtgaaatgctcagctatacccctagctccagcaag
gacaggctctttctcccaacacggagtcaggaagacccctacctctcaatctatgacccc
cctgtaccagacttcaccattatgaagacggaggtccctggctctgtcactgaatacaag
gtcttggcactggactctgccagcatcctcctgatggtacaggggacagtaatagccagc
acacccacaacccagacaccaatccctctgcaacgtggtggcgtgctcttcattggggcc
aatgagagtgtctcactgaagcttactgagccgaaggacctgctgatattccgtgcctgc
tgtctgctgtaa

DBGET integrated database retrieval system