KEGG   Homo sapiens (human): 4351Help
Entry
4351              CDS       T01001                                 

Gene name
MPI, CDG1B, PMI, PMI1
Definition
mannose phosphate isomerase (EC:5.3.1.8)
Orthology
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4351 (MPI)
   00520 Amino sugar and nucleotide sugar metabolism
    4351 (MPI)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     4351 (MPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.1
AA seq 287 aa AA seqDB search
MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAK
ILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEK
LHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLK
QTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQ
LHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGGPWLCH
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggccgctccgcgagtattcccactttcctgtgcggtgcagcagtatgcctgggggaag
atgggttccaacagcgaagtggcgcggctgttggccagcagtgatccactggcccagatc
gcagaggacaagccttatgcagagttgtggatggggactcacccccgaggggatgccaag
atccttgacaaccgcatctcacagaagaccctaagccagtggattgctgagaaccaggac
agcttgggctcaaaggtcaaggacacctttaatggcaacctgcccttcctcttcaaagtg
ctctcagttgaaacacccctgtccatccaggcacaccctaacaaggagctggcagagaag
ctgcacctccaggctccgcagcactaccccgatgccaaccacaagccagagatggccatt
gccctcacccccttccagggcttgtgtggcttccggccagttgaggagattgtaaccttt
ctaaagaaggtgcctgagtttcagttcctgattggagatgaggcagcaacacacctgaag
cagaccatgagccatgactcccaggctgtggcctcctctctgcagagctgtttctcccac
ctgatgaagagtgagaagaaggtggtggtggaacagctcaacctgttggtgaagcggatc
tcccagcaagcggctgccggaaacaacatggaggacatctttggggagcttttgctacag
ctgcaccagcagtacccaggtgatatcggctgctttgccatctacttcctgaacctgctt
accctgaagcctggggaggccatgtttctggaggccaacgtaccccatgcctacctgaaa
ggaggtccctggctctgtcactga

DBGET integrated database retrieval system