KEGG   Homo sapiens (human): 4351Help
Entry
4351              CDS       T01001                                 

Gene name
MPI, CDG1B, PMI, PMI1
Definition
mannose phosphate isomerase (EC:5.3.1.8)
Orthology
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.1
AA seq 423 aa AA seqDB search
MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAK
ILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEK
LHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLK
QTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQ
LHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTP
KFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYK
VLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC
CLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccgctccgcgagtattcccactttcctgtgcggtgcagcagtatgcctgggggaag
atgggttccaacagcgaagtggcgcggctgttggccagcagtgatccactggcccagatc
gcagaggacaagccttatgcagagttgtggatggggactcacccccgaggggatgccaag
atccttgacaaccgcatctcacagaagaccctaagccagtggattgctgagaaccaggac
agcttgggctcaaaggtcaaggacacctttaatggcaacctgcccttcctcttcaaagtg
ctctcagttgaaacacccctgtccatccaggcacaccctaacaaggagctggcagagaag
ctgcacctccaggctccgcagcactaccccgatgccaaccacaagccagagatggccatt
gccctcacccccttccagggcttgtgtggcttccggccagttgaggagattgtaaccttt
ctaaagaaggtgcctgagtttcagttcctgattggagatgaggcagcaacacacctgaag
cagaccatgagccatgactcccaggctgtggcctcctctctgcagagctgtttctcccac
ctgatgaagagtgagaagaaggtggtggtggaacagctcaacctgttggtgaagcggatc
tcccagcaagcggctgccggaaacaacatggaggacatctttggggagcttttgctacag
ctgcaccagcagtacccaggtgatatcggctgctttgccatctacttcctgaacctgctt
accctgaagcctggggaggccatgtttctggaggccaacgtaccccatgcctacctgaaa
ggagactgcgtggagtgcatggcgtgttcagacaacacagttcgtgctggcctgacaccc
aagttcattgatgtgccaaccctgtgtgaaatgctcagctatacccctagctccagcaag
gacaggctctttctcccaacacggagtcaggaagacccctacctctcaatctatgacccc
cctgtaccagacttcaccattatgaagacggaggtccctggctctgtcactgaatacaag
gtcttggcactggactctgccagcatcctcctgatggtacaggggacagtaatagccagc
acacccacaacccagacaccaatccctctgcaacgtggtggcgtgctcttcattggggcc
aatgagagtgtctcactgaagcttactgagccgaaggacctgctgatattccgtgcctgc
tgtctgctgtaa

DBGET integrated database retrieval system