KEGG   Homo sapiens (human): 4352Help
Entry
4352              CDS       T01001                                 

Gene name
MPL, C-MPL, CD110, MPLV, THCYT2, TPOR
Definition
MPL proto-oncogene, thrombopoietin receptor
Orthology
K05082  
thrombopoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Disease
H00227  
Congenital amegakaryocytic thrombocytopenia (CAMT)
Drug target
Romiplostim: 
Eltrombopag: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    4352 (MPL)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4352 (MPL)
Cellular antigens [BR:hsa04090]
 Proteins
  4352 (MPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
1p34
AA seq 635 aa AA seqDB search
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctgggccctcttcatggtcacctcctgcctcctcctggcccctcaaaacctg
gcccaagtcagcagccaagatgtctccttgctggcatcagactcagagcccctgaagtgt
ttctcccgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcgcccagt
gggacataccagctgctgtatgcctacccgcgggagaagccccgtgcttgccccctgagt
tcccagagcatgccccactttggaacccgatacgtgtgccagtttccagaccaggaggaa
gtgcgtctcttctttccgctgcacctctgggtgaagaatgtgttcctaaaccagactcgg
actcagcgagtcctctttgtggacagtgtaggcctgccggctccccccagtatcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggagccagctccagaa
atcagtgatttcctgaggtacgaactccgctatggccccagagatcccaagaactccact
ggtcccacggtcatacagctgattgccacagaaacctgctgccctgctctgcagaggcct
cactcagcctctgctctggaccagtctccatgtgctcagcccacaatgccctggcaagat
ggaccaaagcagacctccccaagtagagaagcttcagctctgacagcagagggtggaagc
tgcctcatctcaggactccagcctggcaactcctactggctgcagctgcgcagcgaacct
gatgggatctccctcggtggctcctggggatcctggtccctccctgtgactgtggacctg
cctggagatgcagtggcacttggactgcaatgctttaccttggacctgaagaatgttacc
tgtcaatggcagcaacaggaccatgctagctcccaaggcttcttctaccacagcagggca
cggtgctgccccagagacaggtaccccatctgggagaactgcgaagaggaagagaaaaca
aatccaggactacagaccccacagttctctcgctgccacttcaagtcacgaaatgacagc
attattcacatccttgtggaggtgaccacagccccgggtactgttcacagctacctgggc
tcccctttctggatccaccaggctgtgcgcctccccaccccaaacttgcactggagggag
atctccagtgggcatctggaattggagtggcagcacccatcgtcctgggcagcccaagag
acctgttatcaactccgatacacaggagaaggccatcaggactggaaggtgctggagccg
cctctcggggcccgaggagggaccctggagctgcgcccgcgatctcgctaccgtttacag
ctgcgcgccaggctcaacggccccacctaccaaggtccctggagctcgtggtcggaccca
actagggtggagaccgccaccgagaccgcctggatctccttggtgaccgctctgcatcta
gtgctgggcctcagcgccgtcctgggcctgctgctgctgaggtggcagtttcctgcacac
tacaggagactgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggc
cagtaccttagggacactgcagccctgagcccgcccaaggccacagtctcagatacctgt
gaagaagtggaacccagcctccttgaaatcctccccaagtcctcagagaggactcctttg
cccctgtgttcctcccaggcccagatggactaccgaagattgcagccttcttgcctgggg
accatgcccctgtctgtgtgcccacccatggctgagtcagggtcctgctgtaccacccac
attgccaaccattcctacctaccactaagctattggcagcagccttga

DBGET integrated database retrieval system