KEGG   Homo sapiens (human): 4353Help
Entry
4353              CDS       T01001                                 

Gene name
MPO
Definition
(RefSeq) myeloperoxidase (EC:1.11.2.2)
  KO
K10789  
myeloperoxidase [EC:1.11.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Transcriptional misregulation in cancer
Disease
H00101  
Other phagocyte defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4353 (MPO)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4353 (MPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     4353 (MPO)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4353 (MPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 745 aa AA seqDB search
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcccttcttctcttctctcagatgcatggtggacttaggaccttgctgggct
gggggtctcactgcagagatgaagctgcttctggccctagcagggctcctggccattctg
gccacgccccagccctctgaaggtgctgctccagctgtcctgggggaggtggacacctcg
ttggtgctgagctccatggaggaggccaagcagctggtggacaaggcctacaaggagcgg
cgggaaagcatcaagcagcggcttcgcagcggctcagccagccccatggaactcctatcc
tacttcaagcagccggtggcagccaccaggacggcggtgagggccgctgactacctgcac
gtggctctagacctgctggagaggaagctgcggtccctgtggcgaaggccattcaatgtc
actgatgtgctgacgcccgcccagctgaatgtgttgtccaagtcaagcggctgcgcctac
caggacgtgggggtgacttgcccggagcaggacaaataccgcaccatcaccgggatgtgc
aacaacagacgcagccccacgctgggggcctccaaccgtgcctttgtgcgctggctgccg
gcggagtatgaggacggcttctctcttccctacggctggacgcccggggtcaagcgcaac
ggcttcccggtggctctggctcgcgcggtctccaacgagatcgtgcgcttccccactgat
cagctgactccggaccaggagcgctcactcatgttcatgcaatggggccagctgttggac
cacgacctcgacttcacccctgagccggccgcccgggcctccttcgtcactggcgtcaac
tgcgagaccagctgcgttcagcagccgccctgcttcccgctcaagatcccgcccaatgac
ccccgcatcaagaaccaagccgactgcatcccgttcttccgctcctgcccggcttgcccc
gggagcaacatcaccatccgcaaccagatcaacgcgctcacttccttcgtggacgccagc
atggtgtacggcagcgaggagcccctggccaggaacctgcgcaacatgtccaaccagctg
gggctgctggccgtcaaccagcgcttccaagacaacggccgggccctgctgccctttgac
aacctgcacgatgacccctgtctcctcaccaaccgctcagcgcgcatcccctgcttcctg
gcaggggacacccgttccagtgagatgcccgagctcacctccatgcacaccctcttactt
cgggagcacaaccggctggccacagagctcaagagcctgaaccctaggtgggatggggag
aggctctaccaggaagcccggaagatcgtgggggccatggtccagatcatcacttaccgg
gactacctgcccctggtgctggggccaacggccatgaggaagtacctgcccacgtaccgt
tcctacaatgactcagtggacccacgcatcgccaacgtcttcaccaatgccttccgctac
ggccacaccctcatccaacccttcatgttccgcctggacaatcggtaccagcccatggaa
cccaacccccgtgtccccctcagcagggtcttttttgcctcctggagggtcgtgctggaa
ggtggcattgaccccatcctccggggcctcatggccacccctgccaagctgaatcgtcag
aaccaaattgcagtggatgagatccgggagcgattgtttgagcaggtcatgaggattggg
ctggacctgcctgctctgaacatgcagcgcagcagggaccacggcctcccaggatacaat
gcctggaggcgcttctgtgggctcccgcagcctgaaactgtgggccagctgggcacggtg
ctgaggaacctgaaattggcgaggaaactgatggagcagtatggcacgcccaacaacatc
gacatctggatgggcggcgtgtccgagcctctgaagcgcaaaggccgcgtgggcccactc
ctcgcctgcatcatcggtacccagttcaggaagctccgggatggtgatcggttttggtgg
gagaacgagggtgtgttcagcatgcagcagcgacaggccctggcccagatctcattgccc
cggatcatctgcgacaacacaggcatcaccaccgtgtctaagaacaacatcttcatgtcc
aactcatatccccgggactttgtcaactgcagtacacttcctgcattgaacctggcttcc
tggagggaagcctcctag

DBGET integrated database retrieval system