KEGG   Homo sapiens (human): 4357Help
Entry
4357              CDS       T01001                                 

Gene name
MPST, MST, TST2
Definition
mercaptopyruvate sulfurtransferase (EC:2.8.1.2)
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Sulfur relay system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hsa00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:hsa04122]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 297 aa AA seqDB search
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV
VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccgcagctctgccgcgcgctggtgtcggcgcaatgggtggcggaggcgctg
cgggccccgcgcgctgggcagcctctgcagctgctggacgcctcctggtacctgccgaag
ctggggcgcgacgcgcgacgcgagttcgaggagcgccacatcccgggcgccgctttcttc
gacatcgaccagtgcagcgaccgcacctcgccctacgaccacatgctgcccggggccgag
catttcgcggagtacgcaggccgcctgggcgtgggcgcggccacccacgtcgtgatctac
gacgccagcgaccagggcctctactccgccccgcgcgtctggtggatgttccgcgccttc
ggccaccacgccgtgtcactgcttgatggcggcctccgccactggctgcgccagaacctc
ccgctcagctccggcaagagccaacctgctcccgccgagttccgcgctcagctcgacccc
gccttcatcaagacctacgaggacatcaaggagaacctggaatcccggcgcttccaggtg
gtggactcccgagccactggcaggttccgcggcaccgagcccgagccccgagacggcatt
gaacctggccacatcccaggtaccgtgaacatccccttcacagacttcctgagccaggag
gggctggagaagagccctgaggagatccgccatctgttccaggagaagaaagtggacctg
tctaagccactggtggccacgtgtggctctggcgtcacagcctgccacgtggcactaggg
gcctacctctgcggcaagccagacgtgcccatctacgatggctcctgggtggagtggtac
atgcgcgcccggcccgaggatgtcatctcagagggccgggggaagacccactga

DBGET integrated database retrieval system