KEGG   Homo sapiens (human): 4358Help
Entry
4358              CDS       T01001                                 

Gene name
MPV17, MTDPS6, SYM1
Definition
MpV17 mitochondrial inner membrane protein
Orthology
K13348  
protein Mpv17
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    4358 (MPV17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 176 aa AA seqDB search
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCG
FVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW
AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcactctggcgggcataccagcgggccctggccgctcacccgtggaaagtacaggtc
ctgacagctgggtccctgatgggcctgggtgacattatctcacagcagctggtggagagg
cggggtctgcaggaacaccagagaggccggactctgaccatggtgtccctgggctgtggc
tttgtgggccctgtggtaggaggctggtacaaggttttggatcggttcatccctggcacc
accaaagtggatgcactgaagaagatgttgttggatcaggggggctttgccccgtgtttt
ctaggctgctttctcccactggtaggggcacttaatggactgtcagcccaggacaactgg
gccaaactacagcgggattatcctgatgcccttatcaccaactactatctatggcctgct
gtgcagttagccaacttctacctggtcccccttcattacaggttggccgttgtccaatgt
gttgctgttatctggaactcctacctgtcctggaaggcacatcggctctaa

DBGET integrated database retrieval system