KEGG   Homo sapiens (human): 4358Help
Entry
4358              CDS       T01001                                 

Gene name
MPV17, MTDPS6, SYM1
Definition
(RefSeq) MPV17, mitochondrial inner membrane protein
  KO
K13348  protein Mpv17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00469  Mitochondrial DNA depletion syndrome (MDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    4358 (MPV17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mpv17_PMP22
Motif
Other DBs
NCBI-GeneID: 4358
NCBI-ProteinID: NP_002428
OMIM: 137960
HGNC: 7224
Ensembl: ENSG00000115204
Vega: OTTHUMG00000097074
Pharos: P39210(Tbio)
UniProt: P39210 A0A0S2Z3Z9
Position
2p23.3
AA seq 176 aa AA seqDB search
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCG
FVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW
AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcactctggcgggcataccagcgggccctggccgctcacccgtggaaagtacaggtc
ctgacagctgggtccctgatgggcctgggtgacattatctcacagcagctggtggagagg
cggggtctgcaggaacaccagagaggccggactctgaccatggtgtccctgggctgtggc
tttgtgggccctgtggtaggaggctggtacaaggttttggatcggttcatccctggcacc
accaaagtggatgcactgaagaagatgttgttggatcaggggggctttgccccgtgtttt
ctaggctgctttctcccactggtaggggcacttaatggactgtcagcccaggacaactgg
gccaaactacagcgggattatcctgatgcccttatcaccaactactatctatggcctgct
gtgcagttagccaacttctacctggtcccccttcattacaggttggccgttgtccaatgt
gttgctgttatctggaactcctacctgtcctggaaggcacatcggctctaa

DBGET integrated database retrieval system