KEGG   Homo sapiens (human): 4359Help
Entry
4359              CDS       T01001                                 

Gene name
MPZ, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, CMTDID, DSS, HMSNIB, MPP, P0
Definition
(RefSeq) myelin protein zero
  KO
K06770  
myelin protein zero
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
H01155  
Roussy-Levy syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4359 (MPZ)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    MPZ; myelin protein zero [KO:K06770]
     4359 (MPZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.3
AA seq 248 aa AA seqDB search
MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVR
YCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGL
GESRKDKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcctggggctccctcatccagccccagccctatcctggctgtgctgctcttctct
tctttggtgctgtccccggcccaggccatcgtggtttacaccgacagggaggtccatggt
gctgtgggctcccgggtgaccctgcactgctccttctggtccagtgagtgggtctcagat
gacatctccttcacctggcgctaccagcccgaagggggcagagatgccatttcgatcttc
cactatgccaagggacaaccctacattgacgaggtggggaccttcaaagagcgcatccag
tgggtaggggaccctcgctggaaggatggctccattgtcatacacaacctagactacagt
gacaatggcacgttcacttgtgacgtcaaaaaccctccagacatagtgggcaagacctct
caggtcacgctgtatgtctttgaaaaagtgccaactaggtacggggtcgttctgggagct
gtgatcgggggtgtcctcggggtggtgctgttgctgctgctgcttttctacgtggttcgg
tactgctggctacgcaggcaggcggccctgcagaggaggctcagtgctatggagaagggg
aaattgcacaagccaggaaaggacgcgtcgaagcgcgggcggcagacgccagtgctgtat
gcaatgctggaccacagcagaagcaccaaagctgtcagtgagaagaaggccaaggggctg
ggggagtctcgcaaggataagaaatag

DBGET integrated database retrieval system