KEGG   Homo sapiens (human): 4363Help
Entry
4363              CDS       T01001                                 

Gene name
ABCC1, ABC29, ABCC, GS-X, MRP, MRP1
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Orthology
K05665  
ATP-binding cassette, subfamily C (CFTR/MRP), member 1
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Vitamin digestion and absorption
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    4363 (ABCC1)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    4363 (ABCC1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4363 (ABCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.1
AA seq 1531 aa AA seqDB search
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccggggcttctgcagcgccgatggctccgacccgctctgggactggaatgtc
acgtggaataccagcaaccccgacttcaccaagtgctttcagaacacggtcctcgtgtgg
gtgccttgtttttacctctgggcctgtttccccttctacttcctctatctctcccgacat
gaccgaggctacattcagatgacacctctcaacaaaaccaaaactgccttgggatttttg
ctgtggatcgtctgctgggcagacctcttctactctttctgggaaagaagtcggggcata
ttcctggccccagtgtttctggtcagcccaactctcttgggcatcaccatgctgcttgct
acctttttaattcagctggagaggaggaagggagttcagtcttcagggatcatgctcact
ttctggctggtagccctagtgtgtgccctagccatcctgagatccaaaattatgacagcc
ttaaaagaggatgcccaggtggacctgtttcgtgacatcactttctacgtctacttttcc
ctcttactcattcagctcgtcttgtcctgtttctcagatcgctcacccctgttctcggaa
accatccacgaccctaatccctgcccagagtccagcgcttccttcctgtcgaggatcacc
ttctggtggatcacagggttgattgtccggggctaccgccagcccctggagggcagtgac
ctctggtccttaaacaaggaggacacgtcggaacaagtcgtgcctgttttggtaaagaac
tggaagaaggaatgcgccaagactaggaagcagccggtgaaggttgtgtactcctccaag
gatcctgcccagccgaaagagagttccaaggtggatgcgaatgaggaggtggaggctttg
atcgtcaagtccccacagaaggagtggaacccctctctgtttaaggtgttatacaagacc
tttgggccctacttcctcatgagcttcttcttcaaggccatccacgacctgatgatgttt
tccgggccgcagatcttaaagttgctcatcaagttcgtgaatgacacgaaggccccagac
tggcagggctacttctacaccgtgctgctgtttgtcactgcctgcctgcagaccctcgtg
ctgcaccagtacttccacatctgcttcgtcagtggcatgaggatcaagaccgctgtcatt
ggggctgtctatcggaaggccctggtgatcaccaattcagccagaaaatcctccacggtc
ggggagattgtcaacctcatgtctgtggacgctcagaggttcatggacttggccacgtac
attaacatgatctggtcagcccccctgcaagtcatccttgctctctacctcctgtggctg
aatctgggcccttccgtcctggctggagtggcggtgatggtcctcatggtgcccgtcaat
gctgtgatggcgatgaagaccaagacgtatcaggtggcccacatgaagagcaaagacaat
cggatcaagctgatgaacgaaattctcaatgggatcaaagtgctaaagctttatgcctgg
gagctggcattcaaggacaaggtgctggccatcaggcaggaggagctgaaggtgctgaag
aagtctgcctacctgtcagccgtgggcaccttcacctgggtctgcacgccctttctggtg
gccttgtgcacatttgccgtctacgtgaccattgacgagaacaacatcctggatgcccag
acagccttcgtgtctttggccttgttcaacatcctccggtttcccctgaacattctcccc
atggtcatcagcagcatcgtgcaggcgagtgtctccctcaaacgcctgaggatctttctc
tcccatgaggagctggaacctgacagcatcgagcgacggcctgtcaaagacggcgggggc
acgaacagcatcaccgtgaggaatgccacattcacctgggccaggagcgaccctcccaca
ctgaatggcatcaccttctccatccccgaaggtgctttggtggccgtggtgggccaggtg
ggctgcggaaagtcgtccctgctctcagccctcttggctgagatggacaaagtggagggg
cacgtggctatcaagggctccgtggcctatgtgccacagcaggcctggattcagaatgat
tctctccgagaaaacatcctttttggatgtcagctggaggaaccatattacaggtccgtg
atacaggcctgtgccctcctcccagacctggaaatcctgcccagtggggatcggacagag
attggcgagaagggcgtgaacctgtctgggggccagaagcagcgcgtgagcctggcccgg
gccgtgtactccaacgctgacatttacctcttcgatgatcccctctcagcagtggatgcc
catgtgggaaaacacatctttgaaaatgtgattggccccaaggggatgctgaagaacaag
acgcggatcttggtcacgcacagcatgagctacttgccgcaggtggacgtcatcatcgtc
atgagtggcggcaagatctctgagatgggctcctaccaggagctgctggctcgagacggc
gccttcgctgagttcctgcgtacctatgccagcacagagcaggagcaggatgcagaggag
aacggggtcacgggcgtcagcggtccagggaaggaagcaaagcaaatggagaatggcatg
ctggtgacggacagtgcagggaagcaactgcagagacagctcagcagctcctcctcctat
agtggggacatcagcaggcaccacaacagcaccgcagaactgcagaaagctgaggccaag
aaggaggagacctggaagctgatggaggctgacaaggcgcagacagggcaggtcaagctt
tccgtgtactgggactacatgaaggccatcggactcttcatctccttcctcagcatcttc
cttttcatgtgtaaccatgtgtccgcgctggcttccaactattggctcagcctctggact
gatgaccccatcgtcaacgggactcaggagcacacgaaagtccggctgagcgtctatgga
gccctgggcatttcacaagggatcgccgtgtttggctactccatggccgtgtccatcggg
gggatcttggcttcccgctgtctgcacgtggacctgctgcacagcatcctgcggtcaccc
atgagcttctttgagcggacccccagtgggaacctggtgaaccgcttctccaaggagctg
gacacagtggactccatgatcccggaggtcatcaagatgttcatgggctccctgttcaac
gtcattggtgcctgcatcgttatcctgctggccacgcccatcgccgccatcatcatcccg
ccccttggcctcatctacttcttcgtccagaggttctacgtggcttcctcccggcagctg
aagcgcctcgagtcggtcagccgctccccggtctattcccatttcaacgagaccttgctg
ggggtcagcgtcattcgagccttcgaggagcaggagcgcttcatccaccagagtgacctg
aaggtggacgagaaccagaaggcctattaccccagcatcgtggccaacaggtggctggcc
gtgcggctggagtgtgtgggcaactgcatcgttctgtttgctgccctgtttgcggtgatc
tccaggcacagcctcagtgctggcttggtgggcctctcagtgtcttactcattgcaggtc
accacgtacttgaactggctggttcggatgtcatctgaaatggaaaccaacatcgtggcc
gtggagaggctcaaggagtattcagagactgagaaggaggcgccctggcaaatccaggag
acagctccgcccagcagctggccccaggtgggccgagtggaattccggaactactgcctg
cgctaccgagaggacctggacttcgttctcaggcacatcaatgtcacgatcaatggggga
gaaaaggtcggcatcgtggggcggacgggagctgggaagtcgtccctgaccctgggctta
tttcggatcaacgagtctgccgaaggagagatcatcatcgatggcatcaacatcgccaag
atcggcctgcacgacctccgcttcaagatcaccatcatcccccaggaccctgttttgttt
tcgggttccctccgaatgaacctggacccattcagccagtactcggatgaagaagtctgg
acgtccctggagctggcccacctgaaggacttcgtgtcagcccttcctgacaagctagac
catgaatgtgcagaaggcggggagaacctcagtgtcgggcagcgccagcttgtgtgccta
gcccgggccctgctgaggaagacgaagatccttgtgttggatgaggccacggcagccgtg
gacctggaaacggacgacctcatccagtccaccatccggacacagttcgaggactgcacc
gtcctcaccatcgcccaccggctcaacaccatcatggactacacaagggtgatcgtcttg
gacaaaggagaaatccaggagtacggcgccccatcggacctcctgcagcagagaggtctt
ttctacagcatggccaaagacgccggcttggtgtga

DBGET integrated database retrieval system