KEGG   Homo sapiens (human): 440Help
Entry
440               CDS       T01001                                 

Gene name
ASNS, ASNSD, TS11
Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hsa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.3
AA seq 540 aa AA seqDB search
MKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNH
KKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYG
VRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEM
VKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGL
DSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGI
QALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAP
SPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKN
GIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANA
AQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcacacagaggtccagatgcattccgttttgagaatgtcaatggatacacc
aactgctgctttggatttcaccggttggcggtagttgacccgctgtttggaatgcagcca
attcgagtgaagaaatatccgtatttgtggctctgttacaatggtgaaatctacaaccat
aagaagatgcaacagcattttgaatttgaataccagaccaaagtggatggtgagataatc
cttcatctttatgacaaaggaggaattgagcaaacaatttgtatgttggatggtgtgttt
gcatttgttttactggatactgccaataagaaagtgttcctgggtagagatacatatgga
gtcagacctttgtttaaagcaatgacagaagatggatttttggctgtatgttcagaagct
aaaggtcttgttacattgaagcactccgcgactccctttttaaaagtggagccttttctt
cctggacactatgaagttttggatttaaagccaaatggcaaagttgcatccgtggaaatg
gttaaatatcatcactgtcgggatgtacccctgcacgccctctatgacaatgtggagaaa
ctctttccaggttttgagatagaaactgtgaagaacaacctcaggatcctttttaataat
gctgtaaagaaacgtttgatgacagacagaaggattggctgccttttatcagggggcttg
gactccagcttggttgctgccactctgttgaagcagctgaaagaagcccaagtacagtat
cctctccagacatttgcaattggcatggaagacagccccgatttactggctgctagaaag
gtggcagatcatattggaagtgaacattatgaagtcctttttaactctgaggaaggcatt
caggctctggatgaagtcatattttccttggaaacttatgacattacaacagttcgtgct
tcagtaggtatgtatttaatttccaagtatattcggaagaacacagatagcgtggtgatc
ttctctggagaaggatcagatgaacttacgcagggttacatatattttcacaaggctcct
tctcctgaaaaagccgaggaggagagtgagaggcttctgagggaactctatttgtttgat
gttctccgcgcagatcgaactactgctgcccatggtcttgaactgagagtcccatttcta
gatcatcgattttcttcctattacttgtctctgccaccagaaatgagaattccaaagaat
gggatagaaaaacatctcctgagagagacgtttgaggattccaatctgatacccaaagag
attctctggcgaccaaaagaagccttcagtgatggaataacttcagttaagaattcctgg
tttaagattttacaggaatacgttgaacatcaggttgatgatgcaatgatggcaaatgca
gcccagaaatttcccttcaatactcctaaaaccaaagaaggatattactaccgtcaagtc
tttgaacgccattacccaggccgggctgactggctgagccattactggatgcccaagtgg
atcaatgccactgacccttctgcccgcacgctgacccactacaagtcagctgtcaaagct
tag

DBGET integrated database retrieval system