KEGG   Homo sapiens (human): 440073Help
Entry
440073            CDS       T01001                                 

Gene name
IQSEC3
Definition
IQ motif and Sec7 domain 3
Orthology
K12495  
IQ motif and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    440073 (IQSEC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.33
AA seq 1182 aa AA seqDB search
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRERIDELERRLDELSAENRSLWEHQQLL
QAQPPPGLVPPSSAPLPAAPATAPAAAARAQEPLQDQGQRSAAAPHPAPDRPPRQHHGQL
LEQPQRGPGSRAHTPQSPHKHLGTQGAVTDKEKERPPSCCAAAGALLQHKSPSALGKGVL
SRRPENETVLHQFCCPAADACSDLASQSDGSCTQAGGGMEDSVVAAAAVAAGRPSAHAPK
AQAQELQEEEERPGAGAASPRAGPQHKASPGRQQPALATALCPHAPAASDYELSLDLKNK
QIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPT
AESLAAEKALMEGYGLVGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTW
SLKTMCSLRESGAYQLHQALQAAAGPPGLEAEGRAPESAGPGPGDDAAETPGLPPAHSGT
LMMAFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEA
PAVGREDASAEDSCAEAAASGAADGATAPKTEEEEEEEETAEVGRGAEAEAGDLEQLSSS
STSTKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLN
LFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCV
VDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIF
ILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELK
SNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFND
LLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFC
ALGSDEMQKFVEDLKESIAEVTELEQIRIEWELEKQQGTKTLSFKPCGAQGDPQSKQGSP
TAKREAALRERPAESTVEVSIHNRLQTSQHNSGLGAERGAPVPPPDLQPSPPRQQTPPLP
PPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYTSSSSDSCGSTPLGGPGSP
VKVTHQPPLPPPPPPYNHPHQFCPPGSLLHGHRYSSGSRSLV
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgctggagaatccggtgcgcgccgtgctctacctcaaggagctcacggcc
atcgtgcagaaccagcagagcctcatccacacccagcgagagcgtatcgacgagctggag
cggcggctggacgagctgagcgctgagaaccgcagcctgtgggagcaccagcagctgctg
caagcccagcctccgcccgggctcgtccccccgtcatcggccccgctgccggccgctccg
gccaccgctcctgccgccgccgccagggcccaggaacctctccaggaccagggacagcgc
tcagcagccgcgccgcatcccgcgcccgatcggccgccgcgtcagcaccacggacagctc
ctggagcagccccagcggggccctggcagcagggctcacacaccccagtcgccccacaag
catctggggacacaaggggccgtgactgacaaggagaaggagcgtcccccgagttgctgc
gctgctgccggagccctccttcagcacaaatccccctccgccctcggcaagggcgtcctg
agcaggagacctgagaatgagaccgtgctgcaccagttctgctgcccagccgccgacgcc
tgctccgacctggcctcccaaagtgatggctcctgcacccaggccggtgggggcatggag
gactccgtggtggcagcggcggcggtggcagccggcagacccagtgcccatgccccgaag
gctcaagcccaggagctgcaggaggaggaggagcggccgggggcaggggctgcctcccca
agggctggcccccagcacaaggcctcccccggccggcagcagcctgccctggcgacggcg
ctgtgcccccacgcccctgccgcctccgattacgaactctcccttgacctaaagaataaa
cagattgaaatgctagaacataagtacggcggtcacctggtgtcccggcgcgccgcttgc
accatccaaaccgccttccgccaataccagctcagcaagaacttcgagaaaatccgcaac
tcgcttctggagagccgcctgccacggcggatctccctgcgcaaggtgcggtcacccacg
gccgagagcctggcggccgagaaagcgctcatggagggctacggcctcgtggggctgccg
ctggtgcgctcgccctccctgccgcccaccttcgcaggcaccctcaccgagctggaggac
tccttcaccgagcaggtgcaatccctggccaagtccatcgacgacgcgctcagcacgtgg
agcctcaagaccatgtgctccctgcgggagagtggcgcttaccagctccaccaggccctg
caggcggccgcggggcccccaggcctggaggccgaggggcgggcgccggagagcgcgggc
cccgggcccggggatgacgccgcggagacccccggcctgcccccggcccacagcgggacc
ctcatgatggctttccgggacgtcacggtgcagatcgccaaccagaacatatccgtctcc
tcctccacggctctgtcggtggccaactgcctgggcgctcagacggtccaggcccccgca
gagcccgcggcgggcaaggccgagcagggcgagacctctgggcgggaggccccggaagcc
cccgccgtgggccgggaggacgcgtcagccgaggactcatgcgcagaggctgcggctagt
ggggcggcggatggggccacagcccccaaaacagaggaggaagaggaggaggaggagacg
gcggaggtggggagaggggccgaggccgaggcaggcgacttggagcagctgagcagcagc
agcacgtccaccaagtccgccaagtcaggctcggaggcgtcggcctccgcctccaaggac
gccctgcaggccatgatcctgagcctgccgcgctaccactgcgagaacccagccagctgc
aagtcgcccacgctctccaccgacaccctgcgcaagcggctctaccgcatcggcctcaac
ctcttcaacataaaccccgacaagggcatccagttcctgatctcacgcggcttcatcccg
gacacccccatcggtgtggcccatttcctcctccagcgaaagggcctcagccgccagatg
attggagagttcctgggcaacagcaagaagcagttcaaccgcgacgtgctggactgcgtg
gtggacgagatggacttctccagcatggagctggacgaggccctgcgcaagttccaggca
cacatccgtgtgcagggggaggctcagaaggtggagcggctcattgaggccttcagccag
cgctactgcatgtgcaaccccgaagtggttcagcagttccacaaccccgacaccatcttc
atcctcgccttcgccatcatcctcctcaacaccgacatgtacagccccaacatcaagcct
gaccggaagatgatgctggaggacttcatccgaaaccttcgaggtgtggacgatggcgct
gacatccccagggagctggtggtaggcatctatgagaggatacagcagaaggagctcaag
tccaatgaggaccacgtcacgtacgtcaccaaggtggagaagtccattgtgggcatgaag
acagtgctgtccgtgccccaccgccgcctggtgtgctgcagccggctcttcgaggtgacg
gatgtgaacaagctgcagaagcaggcagcgcatcagagggaggtgttcctcttcaatgac
ctgctggtgattctcaaactttgcccgaagaagaagagctcctccacgtacaccttttgc
aagtcagttggcctgctgggcatgcagttccagctctttgagaacgagtattactctcat
ggcatcacactggtgaccccgctctcgggctccgagaagaagcaggtgctgcatttctgt
gccctgggctcggacgagatgcagaagttcgtggaggacctgaaggagtccattgctgag
gtgacggagctggagcagatccgaatagagtgggagctggagaagcagcagggaacaaag
acactctccttcaagccctgcggagcccagggggacccacagtcaaagcaaggatcgccg
acagccaaaagggaagccgcgctcagggagaggccggcggagagcacggtggaggtgtca
attcacaacaggcttcaaacgtcccagcacaactccgggctgggggccgagaggggagcg
ccggtgccgccgccagacctgcagcctagccccccgagacagcagaccccaccactgccg
ccgccgccacccacgcccccgggcaccctggtgcagtgccagcaaattgtcaaggtcatt
gtcctggacaagccctgcctggcccgcatggagcccctgctgagccaggctctctcctgc
tacacctcgtcgtcctctgactcctgcggctccacacccctgggcggtcccggctctccg
gtcaaggtcacccaccagcctccgctgcccccgcccccacccccctacaaccaccctcac
cagttctgtcccccaggctccctgctgcacgggcaccgctactccagtggctcaaggagc
ctggtgtag

DBGET integrated database retrieval system