KEGG   Homo sapiens (human): 440153Help
Entry
440153            CDS       T01001                                 

Gene name
OR11H12
Definition
(RefSeq) olfactory receptor family 11 subfamily H member 12
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    440153 (OR11H12)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    440153 (OR11H12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 440153
NCBI-ProteinID: NP_001013372
HGNC: 30738
Ensembl: ENSG00000257115
Vega: OTTHUMG00000170298
Pharos: B2RN74(Tdark)
UniProt: B2RN74
Position
14q11.2
AA seq 326 aa AA seqDB search
MCPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYALTITGNGAI
AFVLWCDWRLHTPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFF
SLGTSECLLLTVMAFDQYLAICRPLLYPNIMTGHLCAKLVILCWVCGFLWFLIPIVLISQ
MPFCGPNIIDHVVCDPGPRFALDCVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAV
LGMPSSTGRHKAFSTCGSHLAVVSLCYSSLMVMYVSPGLGHSTGMQKIETLFYAMVTPLF
NPLIYSLQNKEIKAALRKVLGSSNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccttgaccttgcaggtcactggcctaatgaatgtctctgagccaaattccagc
tttgcttttgtaaatgaatttatactccaaggtttcacttgtgagtggacaattcagatc
ttcctcttctcactctttactacaacatatgcactgactataacagggaatggagccatt
gcttttgtcctgtggtgtgactggcgacttcacactcccatgtacatgttcctgggaaat
ttctcctttttagagatatggtatgtctcttctacagttcccaagatgttggtcaacttc
ctttcagagaaaaaaaacatctcctttgctggatgttttctccagttttatttcttcttc
tctttgggtacatcagaatgcttgcttttgactgtgatggcctttgatcagtaccttgct
atctgccgtcccttgctctatcctaatatcatgactgggcatctctgtgccaaactggtc
atactgtgctgggtttgtggatttctgtggttcctgatccccattgttctcatctctcag
atgcccttctgtggcccaaacattattgaccatgttgtgtgtgacccagggccacgattt
gcattggattgtgtttctgccccaagaatccaactgttttgctacactctaagctcatta
gttatttttggtaacttcctctttattattggatcctatactcttgtcctgaaagctgtg
ttgggtatgccttcaagcactgggagacataaggccttctctacctgtgggtctcatttg
gctgtggtatcactgtgctatagctctcttatggtcatgtatgtgagcccaggactcgga
cattctacagggatgcagaaaattgaaactttgttctatgctatggtgaccccactcttc
aatccccttatctatagcctccagaataaggagataaaggcagccctgaggaaagttctg
ggaagttccaacataatctaa

DBGET integrated database retrieval system