KEGG   Homo sapiens (human): 440153Help
Entry
440153            CDS       T01001                                 

Gene name
OR11H12
Definition
olfactory receptor, family 11, subfamily H, member 12
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
14q11.2
AA seq 326 aa AA seqDB search
MCPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYALTITGNGAI
AFVLWCDWRLHTPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFF
SLGTSECLLLTVMAFDQYLAICRPLLYPNIMTGHLCAKLVILCWVCGFLWFLIPIVLISQ
MPFCGPNIIDHVVCDPGPRFALDCVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAV
LGMPSSTGRHKAFSTCGSHLAVVSLCYSSLMVMYVSPGLGHSTGMQKIETLFYAMVTPLF
NPLIYSLQNKEIKAALRKVLGSSNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccttgaccttgcaggtcactggcctaatgaatgtctctgagccaaattccagc
tttgcttttgtaaatgaatttatactccaaggtttcacttgtgagtggacaattcagatc
ttcctcttctcactctttactacaacatatgcactgactataacagggaatggagccatt
gcttttgtcctgtggtgtgactggcgacttcacactcccatgtacatgttcctgggaaat
ttctcctttttagagatatggtatgtctcttctacagttcccaagatgttggtcaacttc
ctttcagagaaaaaaaacatctcctttgctggatgttttctccagttttatttcttcttc
tctttgggtacatcagaatgcttgcttttgactgtgatggcctttgatcagtaccttgct
atctgccgtcccttgctctatcctaatatcatgactgggcatctctgtgccaaactggtc
atactgtgctgggtttgtggatttctgtggttcctgatccccattgttctcatctctcag
atgcccttctgtggcccaaacattattgaccatgttgtgtgtgacccagggccacgattt
gcattggattgtgtttctgccccaagaatccaactgttttgctacactctaagctcatta
gttatttttggtaacttcctctttattattggatcctatactcttgtcctgaaagctgtg
ttgggtatgccttcaagcactgggagacataaggccttctctacctgtgggtctcatttg
gctgtggtatcactgtgctatagctctcttatggtcatgtatgtgagcccaggactcgga
cattctacagggatgcagaaaattgaaactttgttctatgctatggtgaccccactcttc
aatccccttatctatagcctccagaataaggagataaaggcagccctgaggaaagttctg
ggaagttccaacataatctaa

DBGET integrated database retrieval system