KEGG   Homo sapiens (human): 440387Help
Entry
440387            CDS       T01001                                 

Gene name
CTRB2
Definition
chymotrypsinogen B2 (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
hsa  Homo sapiens (human)
Drug target
Other: 
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     440387 (CTRB2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   440387 (CTRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
16q23.1
AA seq 263 aa AA seqDB search
MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSRTCST
TTPAVYARVAKLIPWVQKILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctcctctcctgctgggccctcctgggtaccaccttcggctgcggg
gtccccgccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
gtccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
gggggctccctcatcagcgaggactgggtggtcaccgctgcccactgcggggtcaggacc
tccgacgtggtcgtggctggggagtttgaccagggctctgacgaggagaacatccaggtc
ctgaagatcgccaaggtcttcaagaaccccaagttcagcattctgaccgtgaacaatgac
atcaccctgctgaagctggccacacctgcccgcttctcccagacagtgtccgccgtgtgc
ctgcccagcgccgacgacgacttccccgcggggacactgtgtgccaccacaggctggggc
aagaccaagtacaacgccaacaagacccctgacaagctgcagcaggcagccctgcccctc
ctgtccaatgccgaatgcaagaagtcctggggcaggaggatcaccgacgtgatgatctgt
gccggggccagtggcgtctcctcctgcatgggtgactctggaggccccctggtctgccag
aaggacggagcctggaccctggtgggcattgtgtcctggggcagccgcacctgctctacc
accacgcccgctgtgtacgcccgtgtcgccaagctcataccctgggtgcagaagatcctg
gccgccaactga

DBGET integrated database retrieval system