KEGG   Homo sapiens (human): 440560Help
Entry
440560            CDS       T01001                                 

Gene name
PRAMEF11
Definition
PRAME family member 11
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Position
1p36.21
AA seq 478 aa AA seqDB search
MKMSIRIPPRLLELAGRSLLRDQALAVSTLEELPTELFPPLFMEAFSRRRCEALKLMVQA
WPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVRPRRWKLQVLDLQDVCENFWMVWSE
AMAHGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEYLTCLLLWVKQRRDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWILPILTQFTPYLGHLRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNTFSFCGNPICMATLENLLSHTIILKNLCLELYPAPQE
SYGADGTLCWSRFAQIRAELMKKVRHLRHPKRILFCTDNCPDHGDRSFYDLEADQYCC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagcatccggattccacccagactcctggagcttgcggggcggagcctgctg
agggaccaagccttggccgtctccaccctggaggagctgcccacggaacttttcccccca
ctgttcatggaggccttcagcaggagacgctgtgaggccctgaagctgatggtgcaggcc
tggcccttccgccgcctccctctgaggcctctgataaagatgccttgtctggaggccttc
caagctgtgctcgatgggctggatgcactgcttacccaaggggttcgtcccaggagatgg
aaacttcaagtgctggatttacaggatgtctgtgagaacttctggatggtttggtctgaa
gctatggcccatgggtgcttcctcaatgccaagaggaacaaaaaaccagtgcaggactgt
ccaaggatgagaggacggcagcccttgactgtgtttgtagaactttggctcaagaacagg
actctggatgaatacctcacctgcctccttctatgggtcaagcagaggagagatttacta
cacctgtgctgtaagaagctgaaaattttgggaatgcccttccgcaatatcagaagcatc
ctgaaaatggtgaacctagactgtatccaggaggtggaagtgaattgcaagtggatactg
cccatcctgacacagtttaccccatacctgggccacttgaggaatcttcagaagctcgtt
ctctcccacatggatgtctctcgctacgtttccccagagcagaagaaggagattgttacc
cagttcaccactcagttcctcaagctgcgctgcctccaaaagctttatatgaactctgtt
tctttcctcgaaggccacctggaccagctgctcagctgtctgaagacctcgttaaaggtc
ctcacaataactaactgtgtgcttttggaatcagacttgaagcatctatcccagtgcccg
agtatcagtcaactaaagaccctggacctgagtggcatcagactgaccaattacagtctt
gtgcctctccaaattctcctagaaaaagttgcagccacccttgagtacctggatttagat
gactgtggcatcatagactcccaagtcaacgccatcctgcctgccctgagccgctgcttt
gagctcaacaccttcagcttctgtggaaatcccatctgcatggccaccctggagaacctg
ctgagccacacaatcatactcaaaaacttatgcctggagctgtatcctgccccgcaggaa
agttatggtgctgatggtactctctgctggagcagatttgctcaaattagggctgagctg
atgaagaaagtgaggcacttaaggcaccccaagaggatcttgttctgtactgacaactgc
cctgaccatggcgacaggtcattttatgacctggaggcagatcaatactgctgttga

DBGET integrated database retrieval system