KEGG   Homo sapiens (human): 441308Help
Entry
441308            CDS       T01001                                 

Gene name
OR4F21, OR4F21P
Definition
olfactory receptor, family 4, subfamily F, member 21
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    441308 (OR4F21)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    441308 (OR4F21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
8p23.3
AA seq 312 aa AA seqDB search
MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNIFIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR
VCKQLVIYKKIS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatggagagaatcactcagtggtatctgagtttttgtttctgggactcactcattca
tgggagatccagctcctcctcctagtgttttcctctgtgctctatgtggcaagcattact
ggaaacatcttcattgtgttttctgtgaccactgaccctcacttacactcccccatgtac
tttctactggccagtctctccttcattgacttaggagcctgctctgtcacttctcccaag
atgatttatgacctgttcagaaagcgcaaagtcatctcctttggaggctgcatcgctcaa
atcttcttcatccacgtcattggtggtgtggagatggtgctgctcatagccatggccttt
gacagatatgtggccctatgtaagcccctccactatctgaccattatgagcccaagaatg
tgcctttcatttctggctgttgcctggacccttggtgtcagtcactccctgttccaactg
gcatttcttgttaatttagccttctgtggccctaatgtgttggacagcttctactgtgac
cttcctcggcttctcagactagcctgtaccgacacctacagattgcagttcatggtcact
gttaacagtgggtttatctgtgtgggtactttcttcatacttctaatctcctacgtcttc
atcctgtttactgtttggaaacattcctcaggtggttcatccaaggccctttccactctt
tcagctcacagcacagtggtccttttgttctttggtccacccatgtttgtgtatacacgg
ccacaccctaattcacagatggacaagtttctggctatttttgatgcagttctcactcct
tttctgaatccagttgtctatacattcaggaataaggagatgaaggcagcaataaagaga
gtatgcaaacagctagtgatttacaagaagatctcataa

DBGET integrated database retrieval system